KEGG   Mus musculus (mouse): 381066
Entry
381066            CDS       T01002                                 

Gene name
Zfp948
Definition
(RefSeq) zinc finger protein 948
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    381066 (Zfp948)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    381066 (Zfp948)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    381066 (Zfp948)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 BolA zf-met zf-C2H2_11 C1_4
Other DBs
NCBI-GeneID: 381066
NCBI-ProteinID: NP_001002008
MGI: 3040683
Ensembl: ENSMUSG00000067931
UniProt: Q6DFU8
Position
17; 17 A3.2
AA seq 667 aa
MAKSPVNMSKHLLTFRDVAVDFSQKEWECLDSAQRALYIDVMVENYSNLVFVEKYSVRDT
VHQHVRTEKESRQCNELGEMLHEPTNCAPYNTSDTTETSNNYRCCNDQDASVDSSNPDRL
KSVHTGEERCEYKDCEKSSSIAQDQRTNSANKEQRQEKHGGHFSSTHSLKSSSIAQDQRT
NSANKEQGQEKHGGHFSSTHSLMQQAIFNREKRYQCGQCQRCFSTSANLTIHQRIHTGEK
PYKCNFCDKSFAQCTTLKTHQRLHTGEKPYKCKECGKSFPQLSALKSHQKMHTGEKPYKC
KECDRFFAHCSSFRRHQKTHRAKKHTGPDCGKDLHQLSHFKSDHRLHTGENPYKCSECDR
SFPHYELFRIHQKTHSSEIDYECEECGKSFTELLQLRRHYKIHSGATLYKCRDCDKSFTQ
YSHLQKHQTIHTGERPYKCKDCEKSFLHNSLLRRHQSVHTGEKPYKCKECDKSFTRNSIL
RQHQKIHTKEKPYKCVECDKSFTQLTYLRTHQRVHTKEKPYNCTVCDKSFTTGATLRIHQ
RVHTGERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTVCDKSFIRYSHLQRHQRVHT
GEKPYKCMECDKSFTECFLLRKHQRIHTEEKPYKCKDCDLAFVCISNLRKHQKNHTGEKH
TVVNNMT
NT seq 2004 nt   +upstreamnt  +downstreamnt
atggctaaatctccagtaaacatgtccaagcatctgttaacatttcgagatgtggccgtg
gacttctcccagaaggagtgggagtgcctggactctgctcagagggctttgtacattgac
gtgatggtggagaattatagcaacctggtgtttgtggagaaatattctgtacgtgatact
gtccatcaacatgtgaggactgaaaaggagtctcgtcagtgtaatgaacttggtgaaatg
cttcatgaacccaccaactgtgcaccttataatacaagtgacactacagaaacctctaac
aactacagatgctgtaatgaccaggatgcctctgttgactcttcaaacccagatagactt
aaaagcgtgcacactggagaagaacgttgtgaatataaagactgtgagaaatcttccagc
attgctcaagatcagagaacaaacagtgcaaacaaagaacagagacaggaaaaacatggt
ggccatttcagctctacacacagtctcaaatcttccagcattgctcaagatcagagaaca
aacagtgcaaacaaagaacagggacaggaaaaacatggtggccatttcagctctacacac
agtctcatgcaacaagcaatcttcaatagagagaaacgataccagtgtgggcaatgccag
agatgcttcagtacctccgcaaacctcactatacatcagagaattcatactggtgagaaa
ccctacaagtgcaacttttgtgacaaatcctttgcccagtgtacaactcttaaaacacac
caacgtcttcatactggagagaaaccttacaaatgcaaagaatgtggaaaatcatttcct
cagttgtcagcacttaaaagccatcagaaaatgcatactggagaaaagccttacaaatgt
aaggagtgtgacagattctttgcccactgttccagtttcaggagacatcagaaaactcat
agagctaagaaacatactggcccagattgtggtaaagacttgcatcagctttcacacttt
aaaagcgatcacagactccatactggagagaacccgtacaaatgcagtgagtgtgacaga
tcctttccccactatgaattatttagaattcatcaaaaaactcattcttcagaaatagat
tatgaatgtgaagaatgtggtaagtcctttactgaattattacaacttagaaggcattac
aaaatccattctggtgcaacactttacaaatgtagagactgtgacaaatcctttacccag
tattcacatcttcaaaaacatcagacaattcatactggagagagaccttacaaatgtaag
gattgtgaaaaatcctttcttcataactcacttcttagacgacatcagagtgttcatact
ggagagaaaccttataaatgtaaggaatgtgacaaatcttttactagaaactccattctt
agacaacatcagaaaattcatactaaagaaaagccttacaaatgtgtagaatgtgacaag
tcctttacccagctcacatatctaagaacacaccaaagagttcatactaaagagaaacct
tacaattgtacagtatgtgacaagtcctttacaacgggagcaactcttagaatacatcag
agagttcatactggagaaagaccatacagatgtacggaatgtggcaaatcttttcgtgaa
ggcacaactcttagaacacataagaaaattcatactggtgagaaaccttacaattgtact
gtatgtgacaaatcttttatcaggtactcacatctccaaagacatcagagagttcatacg
ggagagaaaccttacaaatgtatggaatgtgacaaatcttttactgagtgctttcttctt
agaaagcatcagagaattcatactgaagagaaaccttacaaatgcaaagactgtgactta
gcctttgtgtgtatttcaaatcttagaaaacatcagaaaaatcatactggagaaaaacat
actgttgtaaataatatgacataa

DBGET integrated database retrieval system