KEGG   Mus musculus (house mouse): 381113
Entry
381113            CDS       T01002                                 
Symbol
Cdkl4, AU067824, Gm942
Name
(RefSeq) cyclin-dependent kinase-like 4
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    381113 (Cdkl4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     381113 (Cdkl4)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   381113 (Cdkl4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Haspin_kinase ABC1 RIO1 Seadorna_VP7 APH
Other DBs
NCBI-GeneID: 381113
NCBI-ProteinID: NP_001028615
MGI: 3587025
Ensembl: ENSMUSG00000033966
UniProt: Q3TZA2
Position
17:complement(80830979..80885242)
AA seq 342 aa
MEKYEKLAKIGEGSYGVVFKCRNKSSGQVVAIKKFVESEDDRVVRKIALREIRMLKQLKH
PNLVNLIEVFRRKRKMHLVFEYCDHTLLNELERNPNGVSDGVIKSVLWQTLQALNFCHKH
NCIHRDVKPENILITKQGMIKICDFGFARILIPGDAYTDYVATRWYRAPELLVGDTKYGS
SVDVWAVGCVFAELLTGQPLWPGKSDVDQLYLIIRTLGKLIPRHQSIFRSNQFFRGISIP
EPEDMETLEEKFSNVQPVALSFMKGCLKMNPDERLTCAQLLDSAYFESFQEDQMKRKARS
EGRSRRRQQNQLLPLIPGSHISPTPDGRKQVVQLKFDHLPNI
NT seq 1029 nt   +upstreamnt  +downstreamnt
atggaaaagtatgaaaagctagctaagatcggagaagggtcttatggcgttgtattcaag
tgcagaaacaaatcttctggacaagtagtagcgatcaaaaaattcgtggaatctgaagat
gatcgtgtcgttaggaaaatagccctgcgggaaatccgtatgctgaagcagttgaaacac
ccaaacctcgtgaacctcatcgaggtgttcagaagaaagagaaagatgcatctagttttt
gagtactgtgatcacacactgttaaacgagctggagagaaacccaaacggagtttctgat
ggagtgattaaaagtgtgctatggcaaacccttcaagcccttaacttctgtcacaagcac
aattgtattcatcgggatgtaaaacctgaaaacatcctaataaccaagcaagggatgata
aagatttgtgactttggatttgcacgaattctaattccaggagacgcctacacagactat
gttgccaccaggtggtaccgagcccccgaacttctcgtgggagacacgaagtacggttcc
tctgtagacgtgtgggccgtcggctgtgtttttgcagagctcctgacgggtcagccactc
tggccgggaaaatccgacgtggaccagctttacctgatcatcaggacgttggggaagctg
attccaagacaccagtctatctttaggagtaaccagtttttccgcggcatcagcatacct
gaaccagaggacatggagactcttgaagaaaaattctcaaatgttcagcctgtggcttta
agtttcatgaagggatgcctgaagatgaatcctgatgagaggctgacctgtgcccagctg
ctggacagtgcctactttgagtcttttcaagaggatcaaatgaaaagaaaagcccgcagt
gaggggagaagccgaaggcgccagcagaatcaactgctgcctcttattcctggaagccac
atctcccccacacctgatggaaggaaacaagtcgtccagttaaagttcgatcatcttcca
aacatttag

DBGET integrated database retrieval system