KEGG   Mus musculus (mouse): 381203Help
Entry
381203            CDS       T01002                                 

Gene name
Slc22a20, Gm963, OAT1-L, mOAT6
Definition
(RefSeq) solute carrier family 22 (organic anion transporter), member 20
  KO
K08216  MFS transporter, OCT family, solute carrier family 22 (organic anion transporter), member 20
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    381203 (Slc22a20)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC22: Organic cation/anion/zwitterion transporter
   381203 (Slc22a20)
 Major facilitator superfamily (MFS)
  Organic acid transporters
   Organic cation transporter (OCT) family [TC:2.A.1.19]
    381203 (Slc22a20)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1 Spore_YtrH
Motif
Other DBs
NCBI-GeneID: 381203
NCBI-ProteinID: NP_941052
MGI: 2685809
Ensembl: ENSMUSG00000037451
Vega: OTTMUSG00000035357
UniProt: Q80UJ1
Position
19; 19 A
AA seq 556 aa AA seqDB search
MAFTDLLDALGGVGRFQLVYTALLLLPCGLLACHTFLQNFTAAAPPHHCQHPANYTEPTT
NVSGVWLRAAIPLNQHGDPEPCRRYVEPQWALLKPNASSHGVATEGCKDGWVYDRSIFPS
TIVMEWDLVCEARTLRDLAQSIYMSGVLVGAALFGGLADRLGRKAPLVWSYLQLAVSGAA
TAYVGSFSAYCVFRFLMGMTFSGIILNSLSLVVEWMPTRGRTVAGILLGFSFTLGQLILA
GVAYLIRPWRWLQFAVSAPFLVFFLYSWWLPESSRWLLLHGKAQQAVQNLQKVAMMNGRK
AEGERLTTEVVSSYIQDEFASVRTSNSILDLFRTPAIRRVTCCLMGVWFSNSVAYYGLAM
DLQKFGLSIYLVQALFGIIDIPAMLVATTTMIYVGRRATVSSFLILAGLMVIANMFMPED
LQTLRTVQAALGKGCLASSFICVYLFTGELYPTEIRQMGMGFASVNARLGGLVAPLITTL
GEISPVLPPVSFGATSVLAGMAVACFLTETRNVPLVETIAAMERRVKQGRSKRDTEQKSE
EISLQQLGASPLKETI
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggccttcacagacctgctggatgccctgggaggcgtgggtcgcttccagcttgtctat
acagccttgctgctgctgccctgtgggctgctggcttgccataccttcctacagaacttc
acggctgctgcaccccctcaccactgccaacatcctgccaactacacagaacctaccacc
aatgtctcaggggtctggctgagggctgccatacccctgaaccagcatggggaccccgag
ccgtgccggcgctatgtagaacctcagtgggcccttctgaaacccaacgcctcctcccat
ggggtggccaccgagggctgcaaggatggttgggtctacgaccgaagcattttcccatct
accattgtgatggagtgggacctggtgtgtgaggcccgcacccttcgtgacctggctcag
tccatctacatgtccggggtgttggtgggagccgccttgtttggtggtcttgctgacagg
ttgggtcgcaaggccccactggtgtggtcgtacctgcagctggcagtttcgggggctgcc
acagcgtatgtgggctccttcagtgcctactgcgtcttccgcttcctgatgggcatgacc
ttctccggcatcatccttaactccctctccctggttgtagaatggatgccaaccagaggc
cgtacagtagcaggcatcttgttgggtttctccttcaccttgggccagctcatcctggct
ggcgtggcatacctgatccggccctggcggtggctgcagtttgctgtgtctgctcctttt
ctggtctttttcctctattcttggtggcttccagagtcatcccgatggctcctccttcac
ggcaaggcccagcaagctgtgcagaaccttcagaaggtggccatgatgaatggcaggaag
gcggaaggggagaggctgactacagaggtggtgagctcctacatccaggatgagtttgca
agtgtccgcacctccaactccatcttggacctctttagaacccctgccatcagaagggtc
acgtgctgtctcatgggggtctggttctctaattctgtggcttactacggcctggccatg
gacctgcagaagtttgggctcagcatctacctggtacaggctctgtttgggatcatcgat
atcccggccatgctggtcgccaccaccacgatgatttatgtgggacgacgggccacagtg
tcctccttcctcatactagctgggctcatggtcattgccaacatgtttatgcctgaggat
ctgcagaccttgcggacagtgcaggcagcgctgggcaaaggctgcctggccagctccttc
atctgcgtgtatctgttcacgggagaactctatcccacagagatcaggcagatggggatg
ggatttgcttctgtcaatgcccgcctcggaggcttggtggcacccctgatcaccacactt
ggcgagatcagtccagttctgccacctgtatcctttggtgccacttcagtcttggctgga
atggctgtcgcctgcttcctgactgagacccgcaatgtgccactggtagaaactattgct
gcaatggagagacgagtcaaacaaggccgttccaaaagagacacagaacagaagagtgaa
gaaatttctcttcagcagctgggggcttcacccctcaaagaaaccatttaa

DBGET integrated database retrieval system