KEGG   Mus musculus (mouse): 381246
Entry
381246            CDS       T01002                                 

Gene name
Xkr9, Gm1620, XRG9
Definition
(RefSeq) X-linked Kx blood group related 9
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: XK-related DUF5477
Other DBs
NCBI-GeneID: 381246
NCBI-ProteinID: NP_001011873
MGI: 2686466
Ensembl: ENSMUSG00000067813
Vega: OTTMUSG00000022137
UniProt: Q5GH62
Position
1; 1 A3
AA seq 373 aa
MKYTKCNFMMSVLGIIIYVTDLVADIVLSVRYFHDGQYVLGVLTLSFVLCGTLIVHCFSY
SWLKADLEKAGQENERYFLLLHCLQGGVFTRYWFALRTGYHVVFKHSDRKSNFMEEQTDP
HKEAIDMATDLSMLRLFETYLEGCPQLILQLYAFLECGQANLSQCMVIMVSCCAISWSTV
DYQIALRKSLPDKNLLRGLWPKLMYLFYKLLTLLSWMLSVVLLLFVDVRVALLLLLFLWI
TGFIWAFINHTQFCNSVSMEFLYRIVVGFILVFTFFNIKGQNTKCPMSCYYTVRVLGTLG
ILTVFWIYPLSIFNSDYFIPISATIVLALLLGIIFLGVYYGNFHPNRNVEPQLDETDGKA
PQRDCRIRYFLMD
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgaaatataccaagtgtaattttatgatgtccgttttgggcattataatctatgtaact
gatttagttgcagacattgtcctatctgttaggtacttccatgatggacaatatgttctt
ggtgttttaaccttgagctttgtgctttgtggaacactcatagtccattgttttagctac
tcatggttgaaggctgacttagagaaagcaggacaagaaaatgaacgttattttcttcta
cttcattgcttgcaaggaggagttttcacaaggtattggtttgccttgagaacgggttac
catgtggttttcaaacacagcgacaggaagagtaattttatggaggagcaaacggatcct
cacaaagaagcaatagacatggccaccgacttgagcatgctcaggctgtttgagacctac
ctggaaggctgcccgcaactcattctccagctctatgcctttctggagtgtggccaggca
aatttaagtcagtgcatggtcatcatggtttcctgctgtgctatttcttggtcaactgtt
gactatcaaatagctttaagaaaatcattgcccgataaaaatcttctccgaggactctgg
cccaaactcatgtatctcttttacaagttgcttaccttgttatcctggatgctgagtgtt
gtacttctgctgttcgtagatgtgagggttgctttgcttctgctattatttctttggatc
acaggcttcatatgggcatttataaaccatactcagttttgtaattctgtaagtatggag
ttcttatataggattgtggttggattcatccttgtgtttacattttttaatatcaagggg
cagaataccaaatgcccaatgtcttgttattatactgtaagagtgctaggcaccctggga
atcttgactgtattctggatctaccctctttctatctttaactctgactattttatccct
attagtgccaccatagttcttgctcttctccttgggattatttttcttggtgtttattat
ggaaattttcacccaaatagaaatgtagaaccacaacttgatgaaactgatggaaaagca
cctcagagagattgtagaataagatattttctaatggactaa

DBGET integrated database retrieval system