KEGG   Mus musculus (mouse): 381260
Entry
381260            CDS       T01002                                 

Gene name
Gm973, AW554518
Definition
(RefSeq) predicted gene 973
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF4670
Other DBs
NCBI-GeneID: 381260
NCBI-ProteinID: NP_001013793
MGI: 2685819
Ensembl: ENSMUSG00000047361
Vega: OTTMUSG00000047232
UniProt: Q6GQX7 E9Q295
Position
1; 1 C2
AA seq 1059 aa
MKAVAREPDATSRPLQQRRNTSTEARSAGDYLNWKSPEDYILVSKAQNGDSASQHSWNLF
LPKTFSTRKGALILYSEGLAVSAWTPRDRKRGPRKKQDLGLHTLRDLKEAILAYGRRKRK
QDSAWRPYLYFRSKPESQTQRQIQPGYSAKRYLRGFLRTWPPDIMHRLQCAGHIKDSVLL
QDSQLGIPKNLRPQQDLSGVPPKYHLLPVIPSFRIQQRSSYAQGLDEWEIDTYMDQGSVA
QNHSNPDTHLMSVRRQLWQEDELQAEDTLRESHLRVHASEQSHNGKSQQASREVLGRASF
SYFQLPTDKSLFSFYCGAFPDKQRNMKPHKARGGCLSQEPPVERCLFPPLASAVGSEQNT
LGETKKKKALRTLKLPPVSEEPPGVLKPRRSRFKDSEPPKELFIIPMEIHFHAAQPPKEK
ASRRGARHPESEPEEATPLWWPPMKHLYLERPRGITVHLPVDSSQDTPSPQEDGDILAQS
VNQPLGLLPPMKGKKSSEIQRDMDRTRTSGFSSPTGCPNERAPPAGPEDSRDLTLKHFLL
SPDGENVCLTLPRLMGTEVLPLGQANAGAGASLHGNLYETSSRLAQAAESQERGSELDSH
EEPGGPLRGNAKDSQDPELRNKTLACLSTSLAEYNQPSEADTLKSMDGDYNVHHLHRGPL
KREPAFPKKLASETPRKKKKRRSKLLNQKTGVGINHGKDLVDKAKRKKRTKTHQAKALKK
EREERGLGQAEAAGGKPKHSKIKKKSELTPKKEKLGRKMKRTHKERNMEMAAGLSKSDIT
NSKEAGGTSHQGLLRSHSAAGQLSLELDALESQVAIDGRLSSIQATDVASDMECEEERSH
EDPSKALQDKKQQEKASRDRIRIEKAEMRWLKVEQRRREQEELTWLHKEQLEKAEKMKEE
LELEQQRRTEENRLRKQRLEEERQQQEEAEKKRRLQLQAARERARQQQEELRRKLQEIQR
KKQQEAAERAEAEKQRQKELEMQLAEEQKRLMEMAEEERLEYQQQKLAAEEKARQEAEER
RKQEEEAAKLALEEATKLAQEQIRYLDRGTTAVRACSEA
NT seq 3180 nt   +upstreamnt  +downstreamnt
atgaaagctgttgccagggaaccagatgccacgagcaggccactccagcagcgtaggaat
acaagcacagaggccaggagtgctggagactatttgaactggaagtctccagaagactac
atccttgtcagtaaagcccagaatggggacagtgccagccagcactcctggaacctcttt
cttcctaagaccttcagcacaaggaagggggcactgattctctactcagaagggctagct
gtgtcagcatggacacccagagacaggaaaagaggtcccaggaagaagcaggaccttgga
ctgcacacacttcgggacctcaaagaagccatcttggcatatggaaggagaaagaggaag
caggacagcgcctggcggccttacctctacttccgaagcaagccagagagccagacccaa
cggcagatccagcctgggtattcggccaaaagatacctccgaggctttctgcggacatgg
ccccctgacatcatgcaccggctccagtgtgcaggacacatcaaggattctgtgctgctc
caggacagtcagcttgggatacccaagaatctcaggccacaacaggatctttcaggtgta
cccccaaaataccatctcctgcctgtcatcccttcatttcggattcaacagagatcgtct
tatgcacaaggtctggatgaatgggaaattgatacatacatggaccagggctctgttgct
cagaaccacagcaatccggacacgcacctgatgtcagtcaggaggcagctgtggcaggaa
gatgaactccaggctgaggacacattgagagagagccatctccgtgtccacgcttcggag
caaagtcacaatggaaagagtcagcaagcctccagggaggtccttgggcgggcctcattc
agttactttcagcttcctactgacaaatccctcttctcgttctactgtggagccttccca
gacaaacaaaggaacatgaaaccccacaaggccagaggcggctgcttgtcacaggagcct
cctgttgaaagatgccttttccctcctttagcatcagccgttggctcagaacaaaatacc
cttggggaaacaaagaaaaaaaaggcactgaggactctgaaattacctcctgtttcagaa
gaaccccccggagtcctgaaaccccggaggagccgatttaaagacagtgaacccccaaag
gagctcttcattatccccatggagattcattttcatgccgcacaacccccaaaagaaaag
gccagcagaagaggtgctcggcatcctgagtcagaaccagaagaagccacacctttatgg
tggcctcccatgaagcatctgtacttagaaaggccaagggggataacggtgcatctccca
gtggacagcagccaggacacaccctcacctcaagaagatggtgatatcctggcccagagc
gtgaatcaacccctgggtctcctacccccgatgaaaggaaagaaaagttcagagatccag
agagacatggacagaaccaggacatcgggcttcagcagtcccacaggttgcccaaatgag
agggcaccgccagcaggaccagaagactccagagatctgacattgaaacacttcttgctg
agtccagatggtgaaaacgtctgcctgacgctcccgaggctcatgggaacagaggtgctt
ccactgggacaagcaaacgctggagccggagccagtcttcatggaaatctttatgaaacc
tcctcacgtttggctcaagctgcagagagtcaggaacgtggaagtgaacttgactctcat
gaagaaccaggaggacccctcagaggaaatgccaaagacagccaagacccagaactaagg
aacaagacccttgcctgcctcagtacttccctggctgagtacaaccagccctctgaggct
gacaccttaaagagcatggacggagattacaatgtgcaccacctgcacagaggacctcta
aaacgtgagcctgcattcccaaagaagttggcttctgagactccaagaaaaaagaagaaa
aggagatcaaaactgctcaaccaaaagactggagttggcatcaatcatggaaaggatttg
gttgacaaagctaagaggaagaaaagaaccaagacacaccaggccaaagctctcaagaaa
gagagggaagaaaggggcctggggcaagcagaggctgctggaggaaagccaaagcattca
aaaattaaaaagaaatcagagctaactccaaaaaaagagaaactgggaagaaaaatgaaa
aggacacataaagagaggaatatggagatggcggcagggctgagcaagtcagacatcacc
aactccaaggaagcaggtggcacctcacatcaagggctcctccgctcccactctgcagct
ggacaactttctcttgaactcgatgctctggagagtcaggttgctatagatggaagatta
tcatccatccaggccacagatgttgctagtgacatggaatgtgaagaggagagaagccat
gaagacccttccaaggccctccaggataagaagcagcaggagaaggcttctcgggacaga
attcgaatagagaaggcagagatgagatggctgaaggtggagcagaggagaagggagcag
gaggagctgacttggctccataaggagcagctggagaaagcagagaagatgaaggaggag
ctggagctggagcagcaaagacgcactgaggagaaccgcctgagaaagcagagactggag
gaagaacggcagcaacaggaggaagcagagaaaaaacgaaggctccagttgcaggcagcc
cgggagagagcaaggcagcagcaggaggagctccgcaggaaactgcaagaaatacagaga
aaaaagcagcaggaagcggcagagagggctgaggcagagaagcaaaggcagaaggaactg
gagatgcagttagcagaagaacagaaacgcctgatggaaatggctgaagaagaacggttg
gagtaccaacagcagaaactagcagcagaagagaaagctaggcaggaggctgaggaaagg
aggaaacaggaagaggaagcagcaaagctagccctggaagaagccacaaaactagcccag
gagcaaatcaggtacttggacagggggacaactgctgtcagggcttgttctgaggcttga

DBGET integrated database retrieval system