KEGG   Mus musculus (mouse): 381284Help
Entry
381284            CDS       T01002                                 

Gene name
Crocc2, E030010N08Rik, Gm976
Definition
(RefSeq) ciliary rootlet coiled-coil, rootletin family member 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Rootletin ADIP GIT_CC
Motif
Other DBs
NCBI-GeneID: 381284
NCBI-ProteinID: NP_001297357
MGI: 3045962
Ensembl: ENSMUSG00000084989
Vega: OTTMUSG00000033626
UniProt: F6XLV1
Position
1; 1 D
AA seq 1638 aa AA seqDB search
MSSTSSNPDDGDTTEQSQLGLDTVIKKLEDTILSPMARREDRALTVRGEGQRASPTPVPA
RIREIVSSSLGEEPLSGLREPPATTSHAREESELLQEELTRLEDLLAQADAEREELASRC
HMVSQRLQARLDTTEARLRKSELEHSMDLEEALSRLEASQQRSMGLSQVNTLLRQQLEHM
QKANDTLARELTRATHSLVHLQRKLELQESQRLSLRQPRDILPLWRQAKALQTHLAELRA
STERGLTDVQADMTRTAQRLHMACLNLDSHLRLTASSMTSDLEQRLREQAREMLQLQGQW
AAEKVALQARLSEQTLLVEKLSVQKEQGERAILTLKSDIQRLKSRRSGGQLAVDELRDEV
ESLHHVLASIKEVAQSDAMCPELAWSSSIEVREAQARLRSPPRSVSPHQRMSPARTSSPT
SLHPALQAVQAAIERRQQREQELRLRLESSQEEAAGLREQLSGYRQELRTSQRLLQDRAQ
EHEDLLGQLEAQRQEAQLSQASVHLLEREKEALETTMEELRAKADIREAETQKLEVTNAE
LRRSLLLRAEQKAELAQQSERSLRELEASQGRVEQLEEKVSGLRKELATSREALSSMQLQ
RDILETEKESLHGALAQAESGNADLELLVTRLKAEGMEQQDSLAKMAALLEGLSQDKGTL
NHLALQLEQERDQLREQQKMLQQEQAGMREQLTQTGQQLGLIRAERRSLKETCGHLEQKQ
DHLEKQVVLLGQENAQLREQVGQVTNKKQALEKQLAQSLQDQEAQMDILQEALHEKNTLS
EERAQLLAKQEALERHSELVTKEAADLRAERNSLENSLFEAQRLTTQLQTQQEQLEGKAE
AAQLARRALQVEIERLKSDWEVRETKLQLHLGQLQQQAAQQEQEAQLALERQELAHTEDL
ARLHREKDTLSLSLAEEKEAAARWMEQQKELLTRSAADREALQGEIQNLKQERDESLLQL
EHEMQQALSLKDAEKSLLSKELSGAHRELERARQEAQNQQVQAEATVTTMTKELRTLQVQ
FEEAISTHQREADTLREKLREIAAERSSVRREAEELQAQLNVAHERLAELRQELQASEES
REGLQREALGARRALEDEVQEKDVLQHSNTELRASIHRAEQEKASLKRSKEEQEQKLLLL
QEAQVAAQKEAYELRTRLQELERAQRDTRRKLQERHRQVRTLEAENQRKRQEVSDLQAQV
SRDAQHRQKNLQESLELQRQVAEAQAAHDGVQKEVLGLRQKLAEVEASGETRAKQLEGHL
CESQRAEQTLQAELCRITRKLQEASNQADSLQRSLDNACSRVHVLEQELAKAEGARCNAE
AQLGRLWSTLCSGLGQSRNLLASPKRPHSPTTGSSQTRPGRQRTSPPTRSYSPARWPSPV
PVDPKSEVIDVAFVRDALRDLVQGLLEAQQERDNSGIQVANLSSQLSEAERERLRLQSRV
EQLQRDLADAEEGQRRAESALQSAQAARALQKEALQRLETEHLASARAAGQERRRLQEQV
DTLRQALEESSRPSQSLADKGRLLEQPLQQVLPHSRRDRAERRALREQTTSLRTERARLQ
GELAALRTRLIQTEQETLKKEEDRAMLGAKKELLLQSLSHLHQEVDGALRQSQQLQVASL
KKRLDKEVWQRQQQAHSD
NT seq 4917 nt NT seq  +upstreamnt  +downstreamnt
atgagctccacttccagcaatcctgatgatggagacaccacggagcagtctcagctgggg
ttggacacagtgatcaagaagttggaggacaccatcctgagtcccatggccagaagggaa
gaccgggcgctaactgtgcgaggagaaggtcaacgggcctcacccactcctgtgccagcc
cgtatccgagagatcgtgtcgagcagcctgggtgaggagccactctcagggctgcgggag
ccaccagctactacgtcccatgcacgggaggagagtgaactcctgcaagaggagctgaca
cgattggaggacctgttggcccaggcggatgctgagcgggaagagctggccagcaggtgt
cacatggtcagccagaggctgcaggcccgcctggataccactgaggcccggcttcggaag
tcagagctagaacacagcatggatttggaggaggctcttagccggctggaggcctcacag
cagaggagcatgggcctttcccaagtaaacaccctccttcggcaacagctggagcacatg
cagaaagccaacgacacgttggccagggagctgaccagagcaacacacagcttggtccac
ctgcagcgcaagttggagcttcaagagagccaaaggttgagcctaaggcaacctcgagac
atccttcccctgtggagacaggccaaggctctgcagacacacctggctgagcttcgggca
tccactgagaggggtctcacagatgttcaggcggacatgacccggacggcccagcgcttg
catatggcctgcctgaacctcgactcccacctgcggctgacagccagcagcatgaccagt
gacctggaacagcggctgagggagcaggctagggagatgctccagctgcagggccaatgg
gccgctgagaaggtggcacttcaagccagactctcagagcagacactgctggtagagaag
ctctctgtgcagaaggagcaaggagagagagccatcctgacactcaagtcggacatccag
agactgaaatcccggcgcagtggtggccagctggcggtggatgaactgagggatgaggtt
gaatccctgcaccatgtcctggccagcatcaaggaggtggcccagtcagatgctatgtgt
ccagagttggcctggagcagcagcattgaagtcagggaagcacaggcccgactgcgcagc
ccacctcggtctgtatcaccacaccagcgcatgtccccagctcggaccagctctccaacc
agcctgcatcctgcgctgcaggctgtgcaggcagccattgaaaggcggcagcagcgggaa
caggagttgcgtctgaggctggagtcctcccaagaagaagcagcggggctccgggagcag
ctgtctgggtaccggcaggaactgcggacctcacagaggcttctgcaggacagggcacaa
gagcatgaggatctgctgggccagctggaggcccagaggcaggaggcacagctctcccag
gcgtctgtccatctcctggaaagggagaaagaagccctggagacaacaatggaggagctg
agggccaaggcagacattcgggaggctgagacccagaagctggaggtcacaaacgcagag
ctgaggagaagccttctgctgcgggcggagcagaaagccgagctggcccagcagagtgag
cgcagcctgcgtgagctggaggccagccagggccgtgtggaacagctggaagaaaaggtt
tctgggctcaggaaggagctggccacatcccgggaggcactaagctcaatgcagctgcag
agggacatcttggagacggagaaggagagcctgcatggtgccctggcccaggctgaatct
ggcaatgctgacttggaactgctggtgacacggctgaaggcagagggaatggagcagcag
gactcactggccaagatggctgcccttctggaagggctttcccaggacaaaggcacccta
aaccatctggcacttcagctggagcaggaacgggaccagcttcgggagcagcagaagatg
ctgcagcaggagcaggcgggcatgagagagcagctgacacagacgggacagcagctaggg
ctcattcgggctgagcggagaagtctgaaggagacatgtgggcacctggagcagaagcag
gaccatctagagaagcaggtggtcctgctgggacaggagaatgcccagctccgggagcag
gtgggccaggtcacaaacaagaaacaggccctagagaagcagctggcacagagcctgcag
gaccaggaggcccagatggacattctgcaagaagccctccatgagaagaacacactgtct
gaggagcgggcccaactactggctaagcaggaagccttggagagacatagcgagcttgtg
actaaggaggcagctgatctgagggctgagaggaactctctggagaacagcctctttgag
gcccagcgactgacaacgcagttgcagacccagcaggaacagctagaaggaaaggccgag
gctgctcagctcgctcgccgggccttgcaagtggaaatagagcggctgaaaagtgactgg
gaagtccgagagacaaagctgcagttgcacctgggacagctgcagcagcaggctgcgcag
caagagcaagaggcacagctggccttggagcgccaggagctggcgcacacagaggacctg
gcccggctgcacagggagaaggacaccctcagtttatcactggcagaggagaaagaggcg
gctgcccggtggatggaacaacagaaagagctgttgacaagaagtgcagccgacagggag
gcgctgcagggggagattcagaacctgaagcaggagcgagacgagagcctccttcagctg
gagcacgagatgcagcaggccctgtctctgaaggatgcagagaagagcctgctgagcaag
gagctctctggagctcaccgagagctggaacgggcccggcaggaggcccagaaccagcaa
gtccaagctgaggctaccgttaccaccatgaccaaagagctgagaaccctccaggtccag
tttgaagaggccatctctacccaccagagagaagctgacactctgagggagaagctccgt
gagatagcggccgagcgaagcagcgtgaggagagaggctgaggagctgcaggcacagctg
aacgtggctcacgaaaggctggctgaactgcgtcaggaacttcaggccagtgaagagagt
cgtgaggggctacagagggaggccttgggggctcgccgggcactggaagatgaggttcaa
gagaaggatgtactgcaacattccaacactgagctgcgggcctccatccacagggctgag
caagagaaggccagtttgaagaggtccaaggaggagcaggagcagaagctgctgttgctt
caggaggcccaagtggcagctcagaaggaagcctatgaactgaggaccaggctgcaggag
ttggaacgggcccagagagatacccgtcggaagctccaggagcgccacagacaggtaagg
acactggaagctgagaaccagaggaagagacaggaggtgagtgacctgcaagcccaggtc
tcaagggatgcacagcatcggcagaagaatctgcaggagtcactagagctgcagaggcag
gtagctgaggcccaggctgcccatgatggcgtccagaaggaggttctagggctacggcag
aagttggcagaagtagaggcttcaggggagaccagggcaaagcagctggaggggcatctt
tgtgagagccagagggctgagcagaccctgcaggctgagctgtgtagaatcaccaggaag
ctacaggaggccagcaaccaggctgacagccttcagagaagcctggacaatgcctgtagc
cgagtccacgtcttggaacaggagctggccaaggctgagggtgctaggtgtaatgcagaa
gctcagctgggccggctgtggtccacactctgcagtggcctaggccaaagtcggaacctc
ttggcctctccaaagaggccccattctcccacaacaggcagctcccagactcgtcctgga
cggcaaaggaccagtccccctactagatcctactctcctgcccgatggccctcgcctgta
cctgtggatcctaagtcggaggtcatcgatgtggcctttgtaagggatgccctgagggac
ctggtgcaagggcttctggaggcccagcaggaacgggacaattctggcattcaggtggcc
aatctgagcagccagctgagcgaggcagagagggagcgcctccgcctacagagccgcgta
gagcagcttcagagggacctagcagatgcagaggaaggccagcgcagggcagagagtgca
ctgcagagtgcccaggcagctcgggccctgcagaaggaggcgctccagagactggagaca
gagcatctggcaagtgcacgcgctgcaggccaggagaggagaaggctgcaggagcaagta
gacaccctgcgtcaggccctggaagagagcagcaggcccagccagagccttgcagacaag
gggaggctcctggagcagcccctgcagcaggtgcttccgcacagccgtagggatcgggca
gagcggcgcgccctgcgagagcaaacaacttcactgcgcaccgagcgggcccgcctacag
ggggagctcgcggcactgcgcacgcgcctcatacagacagagcaggagaccctgaagaag
gaggaggacagggcaatgctgggggccaagaaggagctgctgctccagtcgttgagtcac
ctacaccaggaggtggatggggccttacggcagagccagcagctgcaggtagctagcctg
aagaaacggctggacaaggaagtgtggcagcgacagcaacaggcccacagtgactag

DBGET integrated database retrieval system