KEGG   Mus musculus (house mouse): 381306
Entry
381306            CDS       T01002                                 
Name
(RefSeq) cDNA sequence BC055324
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: DUF4487 Sec23_helical
Other DBs
NCBI-GeneID: 381306
NCBI-ProteinID: NP_958752
MGI: 3590554
Ensembl: ENSMUSG00000041406
UniProt: Q3TQQ9
Position
1:complement(163773409..163822377)
AA seq 903 aa
MSQDDAEVASGVVLEELSSWSEEMCRRELPSVLPRLLSMYQCSESWIEHIRILKIIVEMF
LPHMNHLTLEETLFSQVLPKSIKLFDGMICELTSEARELSSQNLEIQVTIRNILQAMVQV
IGGFTGCVRHVCATQKSVFLGSIQSLPSFILHIIKSAFVHCKNSECVYSGRLHLVSDLLQ
VLFKEAYSLQKQLMGLLDTVCLDPSVDENNALIMVGVIHSLLDICSVISGMDQAFHANTW
KFIIKQSLKHHSVIKSQLRHKEIISSLCEDILFSFHSCLQLAEQITQPAAQGNADYRLFQ
KTLKLCRFFANSLLHYTKECLPFLSDSCCTLHQLYLQIHSKFLSLCAAKTSKAQQEEIAS
TFLVLLDPLISQLLKSQPFVQAVLASKLALPCELQLPQVLLLVVAMDKLPSQPQDVQTLW
STEDMTRMSILKGIFYNFGQCSGELSLPTHLQGTKGKGQAEVPVTLYQHVCVHLCAFVAS
FHSSLFPRLDAALLNAVLSTNMSTSLLAMDVWCFLARYGTAKLGAHHVTLVAHLVKSCPG
KCVQLTNLSILLKRLLFFMAAPHQVQFIQKFSPKEADNLHLWQYISLQAFDADLRKPVAC
ELVRVCRAQCRKWLSSTRTLAELDSLNTALSVVLTVCNSAGEALDSRQLTAVTEVLGELW
TFINVEQIISQPYVQQAFSLLLQLLAFFIQTVDLQLISQVVNVLTSVIKLEPPDHVSLAV
LDFISSLGKLYISQTIRDKVLPSLSCILTSLIVNKNWLLEQHTLEAFTQFAEGTKHEEIV
PQCLGSEEIKNKVVSFLEKTESVDEAEVATVDNVKQEKGTFWEPAAKVTVEEVKTSAFQP
HTKRARRVLPFEEEYRSVFKAAARALETTEFLLKHSLAPAWLLPELEALQGRIEKLKRCV
LTG
NT seq 2712 nt   +upstreamnt  +downstreamnt
atgtcgcaggacgatgcggaggtggcgagcggggtcgtgctggaggaactcagcagctgg
tcggaggagatgtgccgtcgggagctgccttcggtgctgccccggctcctctctatgtat
caatgttctgaaagttggattgaacatatccgaattttaaaaatcattgttgaaatgttt
ttgcctcatatgaaccacctgacactggaagaaactttgttttcccaagttttaccaaag
agtataaaattgtttgatggcatgatatgtgaattaaccagtgaagccagagaactctcc
agccaaaatttagaaatccaggtcaccataaggaacattttacaagcaatggtgcaggtc
ataggaggttttacaggatgtgtccgtcatgtctgtgccacacagaaatctgtctttcta
ggaagtattcagagtcttccctcattcatcctgcatataattaaaagtgcatttgtgcac
tgtaagaacagcgaatgtgtgtattctgggcgcttacacctagtgtcagaccttctccag
gttctgttcaaggaggcctattctctccagaagcagctgatgggactgctggacacggtt
tgcctggacccttcagtagatgagaataacgctttgataatggtaggagttattcattca
ttattggatatctgctctgttatctctggtatggaccaagcatttcatgccaatacttgg
aagtttattattaagcagagcctcaaacaccactcggttataaagagccagttgagacac
aaagagatcatttctagcttgtgtgaagacattcttttctcctttcattcttgtttacag
ttagctgagcagataacacagccagctgcacagggtaatgctgactacaggttatttcaa
aaaacactgaaattgtgtcgtttctttgctaactcccttttgcactacactaaggaatgt
cttcctttcctgtctgattcttgctgtactctgcaccagctttatctgcagatacacagc
aagtttctaagcctctgtgctgccaagacttccaaagcccagcaggaggaaatagcaagc
actttccttgtgctactggacccactcatcagtcagctgctcaaatcccagccttttgtg
caggcagttttggcgagtaaacttgccctgccctgtgagctgcagctcccacaagtccta
ctcctggttgtcgccatggataaactgccctctcagccacaggacgtgcagaccctgtgg
agcacagaggatatgactaggatgtccatactgaaaggaattttctacaattttggccag
tgttctggtgaactctctctgcctactcatttacaaggaacgaagggtaaaggacaagct
gaggtgcctgtcacgttgtatcagcatgtttgtgttcatctgtgtgcatttgtggcttct
tttcattcttcattgtttcctcggctggatgctgctctattgaatgctgtgcttagtacc
aatatgagtacctctttgttagcgatggatgtgtggtgcttccttgctcggtatgggact
gctaaacttggtgcacaccatgtcaccctagtggctcatctggttaaatcttgccctgga
aaatgtgttcagcttaccaacctctccatactgttgaagcgcctccttttcttcatggct
gcaccccatcaggtgcaattcatccagaaattttctccaaaagaagcagacaacttgcat
ttgtggcagtatatttccctccaggcgttcgatgctgatctcaggaagccggttgcatgt
gaattggtcagagtgtgcagagcacagtgcaggaagtggttgagcagcactcggactctg
gcagagcttgactctctgaacacagcactttctgttgtacttactgtctgcaattctgct
ggagaagctttggatagtagacagctaactgcagttactgaagttttgggtgagctttgg
actttcataaacgttgaacaaattatcagtcagccctatgttcaacaggcatttagcctt
ttacttcaactgctggcgtttttcatccaaactgtagatctgcagctgataagtcaggtt
gtaaatgtcctgacttcggtgattaaactagagcctcctgaccacgtctctttggcagtg
ctggattttatatcgtctctgggcaaactttatatatctcaaactatccgggacaaggtg
ctgcccagcttgtcttgtattcttacttcactgatcgtcaacaagaattggttgctagag
caacatactttggaggcatttactcagtttgctgagggaacaaagcatgaagagatagtt
ccacagtgtctcggttctgaagaaatcaagaacaaagttgtatcctttttggagaagaca
gaatctgtagatgaagctgaggttgccacagtggacaatgtgaagcaggagaaaggcact
ttctgggaacctgctgctaaggtgactgtagaagaagtgaagacgtcagcgtttcagcct
cacacaaagagagcccgtcgggtgttgccctttgaagaagaatacagatcagtatttaaa
gctgcagcaagggctttggagacaactgagtttttactcaaacactctcttgctccagca
tggctgctgccagaactggaggcgctgcaaggaaggatcgagaagctaaaacgctgtgtg
cttacagggtaa

DBGET integrated database retrieval system