KEGG   Mus musculus (house mouse): 381310
Entry
381310            CDS       T01002                                 
Symbol
Stum, 6330403A02Rik, Gm10001, R75555
Name
(RefSeq) mechanosensory transduction mediator
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: Spec3 NDUF_B12
Other DBs
NCBI-GeneID: 381310
NCBI-ProteinID: NP_001074696
MGI: 2138735
Ensembl: ENSMUSG00000053963
UniProt: Q0VBF8 Q8CCZ7
Position
1:complement(180259938..180311199)
AA seq 141 aa
MEPLHKDAETAAAAAAVAAADPRGASSSSGVVVQVREKKGPLRAAIPYMPFPVAVICLFL
NTFVPGLGTFVSAFTVLCGARTDLPDRHVCCVFWLNIAAALIQVLTAIVMVGWIMSIFWG
MDMVILAISQGYKDQGIPQQL
NT seq 426 nt   +upstreamnt  +downstreamnt
atggagcctttgcacaaagacgccgagaccgcggcggcggcggcggctgtggcagcggca
gatccccggggggcatcgtcgtccagcggggtggtcgtgcaggttcgcgagaagaagggg
cccctgcgcgccgccatcccctacatgcccttcccggtggctgtcatctgtctcttcctc
aacactttcgtgccgggattgggtacattcgtctcggcattcactgtgctgtgtggggca
cgcaccgacctcccggacaggcacgtgtgctgcgtcttctggctgaatatcgctgcggcc
ctcattcaggtgctcacggccatcgttatggtgggctggatcatgagcatcttctggggc
atggacatggtcatccttgccatctcccaagggtacaaggatcagggtatcccacaacag
ctgtga

DBGET integrated database retrieval system