KEGG   Mus musculus (mouse): 381314
Entry
381314            CDS       T01002                                 

Gene name
Iars2, 2010002H18Rik, C79125
Definition
(RefSeq) isoleucine-tRNA synthetase 2, mitochondrial
  KO
K01870  isoleucyl-tRNA synthetase [EC:6.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    381314 (Iars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mmu01007]
    381314 (Iars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mmu03016]
    381314 (Iars2)
Enzymes [BR:mmu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.5  isoleucine---tRNA ligase
     381314 (Iars2)
Amino acid related enzymes [BR:mmu01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   381314 (Iars2)
Transfer RNA biogenesis [BR:mmu03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    381314 (Iars2)
 Prokaryotic type
   Other AARSs
    381314 (Iars2)
Motif
Pfam: tRNA-synt_1 Anticodon_1 tRNA-synt_1g tRNA-synt_1_2 zf-FPG_IleRS tRNA-synt_1e DZR_2
Other DBs
NCBI-GeneID: 381314
NCBI-ProteinID: NP_941055
MGI: 1919586
Ensembl: ENSMUSG00000026618
Vega: OTTMUSG00000021852
UniProt: Q8BIJ6
Position
1; 1 H5
AA seq 1012 aa
MHWGLCPRGPGAAAVAAAGSFWGPARLPSRLGCLGMTRRLVVRSVAGADSPQSSSKGGRY
RDTVLLPQTSFPMKLLGRQQSDMELEIQQKCGFSELYSWQRERKVKTEFCLHDGPPYANG
DPHVGHALNKILKDIANRFHMMRGSKVHFVPGWDCHGLPIETKVLSELGVDAQSLSAMEI
REKARSFAQAAIEKQKSAFVRWGVMADWNNCYYTFDPKYEAKQLRVFYQMYEKGLVYRSY
KPVYWSPSSRTALAEAELEYNPEHVSRSIYVRFPLLRPPPKLESLTDASSPVSVLVWTTQ
PWTIPANQAICYMPEAKYAVVKCSASGHLYILAEDKIAPVASALETTFDVVAAFSGVDLE
GGTCSHPLTPDKVSPLLPATHVTMAKGTGLVHTAPAHGMEDYSVASQHSLPMDCLVDEGG
MFTDAAGPELQNKAVLKEGTDVVIKMLQATKNVLKEENIVHSYPCDWRTKTPVLIRASKQ
WFVNITDIKAAAKESLKTVKFIPGAALNSMTDMLDRRPYWCISRQRVWGVPIPVFHHKTK
DEYLINSQTTEHIIKLVEQHGSDVWWTLPAEQLLPAEVLAQAGGPGALEYAPGQDILDIW
FDSGTSWSCVLQDTQQRADLYLEGKDQLGGWFQSSLLTSVATRSKAPFRTVMVHGFTLGE
KGEKMSKSLGNVINPDTIISGGKDHSKEPPYGADILRWWIAESNVFTEVTIGPSVLSAAR
DDISKLRNTLRFLLGNLTGFNPETDSVPVKNMYVIDQYMLHLIQDFATKITDSYKQYDFG
KVVRLLKAFYTRELSSFYFSIVKDRLYCENEKDPKRRSCQTALAEILDVLVRAFAPILPH
LAEEVFQHIPYVTEPKSVFRTGWINTSSIWKKPGLEEAVESACAMRDSFLGSIPGKNAAE
YEVIIVIEPGLLFEIMEMLQAEETSSTSQLNELMMASQTTLLAQEPRERTAGDIELTGTF
VINLEGGDIREESSYKVIVVPTAREKCPRCWKHTSETADALCPRCAEVIGAK
NT seq 3039 nt   +upstreamnt  +downstreamnt
atgcactgggggctgtgccctcgcgggcccggggcggcggcggtcgccgcggctgggagc
ttctgggggccagcccgtttgcccagccgcctagggtgtctggggatgacgaggaggctc
gtggtacgatccgtggccggggcggacagcccccagagcagctcgaaaggcggcagatac
cgtgacacggtgctgctgccgcagaccagcttcccgatgaagctgctgggccgccagcag
tccgacatggagctggagatccagcagaaatgtggcttttcagagctttattcctggcaa
agagaaagaaaagtaaagacggaattttgccttcatgacgggcctccttatgccaacggt
gaccctcatgttgggcatgccctgaacaagattttgaaagacattgccaatcgattccat
atgatgagaggttccaaggtacactttgtgcctggctgggattgccatggcttgcccatt
gaaacaaaagtgttatcagagctcggtgtagatgcccagagtctttcagccatggagatc
agggagaaagccagatcatttgctcaggcagccattgaaaagcagaaatcggcgtttgtc
cgctggggagtgatggcagactggaataactgctattacacatttgacccaaagtacgaa
gccaagcagctgagagtattctaccaaatgtatgagaagggcttggtttatcgatcttac
aaaccagtatattggtctccctcatcaaggactgcgttggctgaagcagagcttgaatac
aaccctgagcatgtcagtcggtcgatatacgtaagattccccctcctgagacctcctccg
aagttggagtctcttacagatgcctcatcccctgttagcgttttagtttggaccacccag
ccttggacaattcccgccaaccaggcaatttgctatatgccagaggcaaagtatgctgtg
gtgaaatgttctgcctctgggcacctctacatcctggctgaagataaaatagcacctgtc
gcttctgccttggaaacaacatttgatgttgttgcagcattttcaggtgtggatctggaa
ggtggcacttgtagtcaccctttaactcccgataaagtgtctcctcttttacctgctacc
cacgtgactatggccaaaggaacagggttggttcacacagccccagctcacggtatggaa
gattacagcgtagcatctcagcacagcctccctatggactgtttagtggatgaaggcgga
atgttcaccgatgccgcaggccctgaacttcagaacaaggctgtacttaaagaaggaaca
gatgtggttataaagatgcttcaagctaccaagaatgtgttgaaagaagagaacattgtg
cacagctatccctgtgactggagaactaagacacccgtgctgattcgagccagcaagcag
tggtttgtaaatatcacggacatcaaggctgcagctaaggagtcgttgaagacggtgaag
ttcattcccggagccgcactgaacagcatgacggacatgctggacagacggccgtactgg
tgcatatcccggcagagagtctggggggttcccattcctgtgtttcatcataagacaaaa
gatgaatatttgatcaacagccaaaccactgagcatattattaaactcgtcgagcagcac
ggcagtgatgtgtggtggaccctccctgctgagcagcttctcccggcagaagtcctagct
caggctggtggccctggggctttggaatacgcgccagggcaggacattttggacatctgg
tttgacagtggaacttcatggtcttgtgttcttcaagacacgcagcagagggcagacttg
tacctggagggaaaggaccagctcgggggctggttccagtcttccttactaacaagtgtg
gccaccaggtcaaaagcacctttcaggacagtgatggttcatggatttacacttggagaa
aaaggagaaaagatgtccaagtccctcgggaatgtcattaatcctgacactatcatcagt
ggaggaaaagaccacagcaaagaacctccctacggagctgacatcctgcgctggtggata
gctgagtccaatgtcttcacggaggtgaccattggcccctctgtactctctgctgccaga
gatgacatcagcaagctcagaaacacactccgctttctcttgggaaatttgaccggtttt
aaccccgagacagattctgttcccgtgaagaatatgtatgtcatagaccagtatatgctg
cacttaattcaggattttgcgacaaagattactgactcatacaaacagtatgactttggg
aaagttgtcaggctgttgaaagccttctacaccagagaactgtccagcttttacttcagc
atagtcaaggataggctctactgcgaaaacgagaaggatcccaagcgccgctcgtgtcag
acagcattggcagaaattttggatgtgttggtccgtgcttttgcccccattcttcctcac
ttggcagaagaggtgtttcagcacattccctatgttacagaacccaagagtgtttttcgc
actggctggattaatacaagctctatttggaagaagccaggactggaggaggcagtggaa
agtgcgtgcgccatgagggactcctttcttggcagcatccctggcaaaaatgctgctgag
tacgaggtcatcatagtgatcgagccagggctgctgtttgagatcatggagatgctccaa
gctgaggagacctctagcacgtctcagctgaatgagctgatgatggcttcccagacgaca
ttgctggctcaggagccacgggaaagaactgcaggtgacattgagctcacggggacattc
gtcatcaatctagaaggtggtgacattcgtgaggagtcttcatataaagtcattgtggta
ccgactgccagagagaagtgccctcgatgttggaagcatacctctgagactgcagacgct
ctctgtcctcggtgtgcagaggtcattggtgcaaagtag

DBGET integrated database retrieval system