KEGG   Mus musculus (mouse): 381318
Entry
381318            CDS       T01002                                 

Gene name
Nsl1, 4833432M17Rik, AI451597, Gm105, Gm984
Definition
(RefSeq) NSL1, MIS12 kinetochore complex component
  KO
K11545  kinetochore-associated protein NSL1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    381318 (Nsl1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    KMN network proteins
     MIS12 complex
      381318 (Nsl1)
SSDB
Motif
Pfam: Mis14 Peptidase_S77
Other DBs
NCBI-GeneID: 381318
NCBI-ProteinID: NP_941056
MGI: 2685830
Ensembl: ENSMUSG00000062510
Vega: OTTMUSG00000029639
UniProt: E9QME3
Position
1; 1 H6
AA seq 281 aa
MAAVSETVLVSAPQDHDAQAASDPQATAADSPLEDFRVRCTLKRAVMEVMEMCGRFVQEL
GAVLPEDVRELALRDAQWTFESAVQENVSFNGQAWEEAKEHGLMDSDIKVLEDEFDELIV
DVATKRRQYPRRILESVIKTLKAQHASLKQYHPVVHPLDLKCDPDPASRVEDLKCRGEAI
AKEMSEAMKALPVLIEQGEGFSQVLKMRPVIQLQRINQEVFSSLYRKADSKPDTRVTHVE
TTPAETGARKASDIVLKRKKAPDCAQRKRYPLRLQRINLDM
NT seq 846 nt   +upstreamnt  +downstreamnt
atggcggctgtctctgaaacagtgctcgtctccgccccgcaggaccacgatgcccaggcc
gcctcagaccctcaggccacggcagcagactctcccctagaggacttccgagtgcgctgc
accttgaagagggcggtgatggaagtgatggagatgtgcggtcgcttcgtgcaggagctc
ggggccgtgctgccggaggacgtccgcgagctcgcgctgcgggacgcacagtggacattt
gagtcggctgtgcaggagaacgtcagctttaacggacaggcctgggaggaagctaaagag
catggcttaatggattctgacatcaaagtgcttgaagatgaatttgatgagctcatagta
gatgtggcaaccaaacggaggcagtatcccagaaggatccttgagagtgtcatcaaaacc
ttgaaagcacagcacgcgagtctgaagcagtatcaccctgttgtacatcctctggacctg
aaatgtgaccctgacccagcttctcgtgtagaagatttgaaatgccgcggagaagccata
gctaaggaaatgagtgaggccatgaaggctttgcctgtgctaattgaacaaggagaaggc
ttttcccaggtcttaaagatgcgacctgtcatccagctacagaggatcaaccaggaagtc
ttctccagcctctacaggaaagctgactccaagcctgacacacgtgtgacacacgtagaa
accacaccagccgagactggagccaggaaggcctccgacattgtgctaaagagaaagaaa
gccccagactgtgcccagagaaagcgctacccgctgcggctgcagagaattaatctcgat
atgtga

DBGET integrated database retrieval system