KEGG   Mus musculus (mouse): 381334Help
Entry
381334            CDS       T01002                                 

Gene name
Gal3st2, GP3ST, Gm988
Definition
(RefSeq) galactose-3-O-sulfotransferase 2
  KO
K09675  galactose-3-O-sulfotransferase 2 [EC:2.8.2.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    381334 (Gal3st2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.2  Sulfotransferases
    2.8.2.-  
     381334 (Gal3st2)
Glycosyltransferases [BR:mmu01003]
 Unclassified
  Sulfotransferases
   381334 (Gal3st2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gal-3-0_sulfotr Sulfotransfer_2 DUF3330
Motif
Other DBs
NCBI-GeneID: 381334
NCBI-ProteinID: NP_955398
MGI: 2685834
Ensembl: ENSMUSG00000094651
Vega: OTTMUSG00000048690
UniProt: A2RTS9 Q3UN22
Position
1; 1 D
AA seq 396 aa AA seqDB search
MSILRGTQRSFQVALWFLVLAVFLLVGFLHVDFRLLKPDKVQEPPVTNIMFLKTHKTASS
TILNILYRFSESHNLSTALPEGSRVHLGYPWFFVTRYVEGLKQDAHLQHHFNIMCNHLRF
NYPEVQKVMPRDTFYFSILRNPVFQLESSFIYYKDYAPAFQRAKSLDEFLADPWKYYNAS
VSLKNVYAKNNMWFDFGFDNNAPADMDYVRKRLAEVEQRFHLVLIADYFDESMVLLRRRL
RWQLDDVVSFKLNVRSQSTVSHLTPESQERVRHWCALDWQLYQHFNRTFWTQLHAELSPR
QLTEEVEQLRERQRELMALCLQDPEPKNLTHIDDQNLRPYQGGKANILGYNLRHGLDTTT
LHICQRMAMPELQHMAHMYSLQFPDKTPKDIPFLKK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcctgagaggcacacagaggtccttccaggtggcactctggttcctggtcctg
gctgtgttcctcctggttggtttcctgcatgtggacttcagactacttaaaccggacaag
gtccaggaaccaccggtcacaaacatcatgttcctcaagacgcacaagacagccagcagt
acaatcctcaacatcctctaccgcttctcagagtctcacaacctatccacagcactgccc
gagggctctagagtccatctgggttacccctggttttttgtgacacggtatgtggagggc
ctgaagcaggacgcccacctgcagcatcactttaacatcatgtgcaaccaccttcggttc
aactatcctgaggtgcagaaagtcatgcccagggacactttctacttctccatcctccgg
aacccagttttccagctggagtcctccttcatctactataaggactatgcacctgccttc
cagagagccaagagcctggacgaattcctggcagatccgtggaagtactacaacgctagt
gtgagcctgaaaaatgtctatgcgaaaaacaacatgtggtttgattttggttttgacaac
aacgccccagcagacatggactatgttcgcaagcgccttgcggaggtggagcagcgattc
catctggtgctcattgcagactacttcgatgagtctatggtgctgctgcgcagaaggctg
cgctggcagctggatgatgtcgtgtccttcaagctgaacgtgcgcagccagagcactgtc
tcacacctgacgcctgagagccaggagcgtgtccggcactggtgtgcgctggactggcag
ctctaccagcatttcaatcgcacgttttggacccagctgcatgcggagctaagcccacgc
cagctcacagaagaggtggagcagctgcgggagaggcagcgcgagctcatggccctgtgt
cttcaggatccagagcccaagaacctgacacacatagatgaccagaatctgcgtccttac
cagggtgggaaggccaatattctgggctacaaccttaggcatggtctggacaccaccaca
ctgcatatctgtcagagaatggcgatgcccgagctccagcacatggcccatatgtactct
ctgcagtttcccgacaagactcccaaggatatcccattcctgaaaaagtag

DBGET integrated database retrieval system