KEGG   Mus musculus (house mouse): 381337
Entry
381337            CDS       T01002                                 
Symbol
Fam178b, 1700024G10Rik, Gm990
Name
(RefSeq) family with sequence similarity 178, member B
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: CANIN
Other DBs
NCBI-GeneID: 381337
NCBI-ProteinID: NP_001119518
MGI: 3026913
Ensembl: ENSMUSG00000046337
UniProt: Q24JP3 E9PXB2
Position
1:complement(36601777..36722271)
AA seq 523 aa
MQMPRDSFPTDWSPPPVEFLNKPKKAPPAKKGPLEDLEKDPPDPNQKVELASLEELFWNM
ASPSQQAGTPEISSGSSQCYINNLDYLLQEKRMLVEKFSVSLQVISPVHPGETVFLPRRH
PLPCFLDSSRLKPHSPLEELFLRSSLPEQLSFLHNGLLSNLYLHAADCPQPLLQWLFQLL
TWPPETSSRAFGLLWDLSIDGLFRQPDEDMHFWCPSLQEVKEVFSSLGAYNPALYPQGPF
QHSARVLESEASLDSQDPPQEVALDIKLNYIYKFLTLCLLVRPVSYTDASILDLMELLCR
AGLDVGLCLLPKTDLQQLLLLLLERIQEWPGKLQPLCCALSWVSDHHHNLLALVQFFLDV
TPRGRQLRSQLSLVIIARMLGQQESLPFSAEKTQLALLSQLLSLMRPSSLRQCLGIETLP
SSLGQHSKASAELDYKVCYLCHSLLTLAGVVVSSQDITPNQWGELQLLCMQLDRHISTHI
RESPQAMHRTKLKDLATQTYIRWQDLLAHCQPQGQYFSPWKDI
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgcagatgcccagggactcgttccccactgactggagcccacctcctgtagagttccta
aacaagcccaagaaagcacctccagccaaaaagggaccccttgaggacttggagaaggac
cctccagatcccaaccagaaggtggagctggcctccctggaggagctcttctggaacatg
gcaagtccaagccaacaggctgggaccccagagatttcctctgggagctcacaatgctac
atcaataacttagattacttactgcaagaaaagaggatgctggtggagaagttctccgtg
tccctgcaggtcatctcgccagtgcatccgggtgaaactgtattcttgcctaggcgtcac
cctttgccttgcttcctggactcctctcgtctaaagccgcacagcccattggaagagctg
ttcctcaggtcctcgctgcccgagcagctctccttcctacacaatggcctcctgagcaac
ctctacctgcatgctgctgactgccctcagcctctgctgcagtggctgttccagttgtta
acatggcctccagaaacatcttcaagagcttttggcctcctctgggatctcagtatagat
ggactgttccgtcagcctgatgaagacatgcatttctggtgtccctcactgcaggaggtc
aaagaggtgttcagcagcctgggagcctacaaccccgccctgtacccacaggggcccttc
cagcacagcgcaagggtgcttgagagtgaggccagcctggattcacaggatcctccccag
gaagtggccttggacattaagttgaactacatctacaagttcctgaccctgtgtctccta
gtccggccagtgtcctacacggatgccagcatcttggatctgatggagctgctgtgccgc
gcaggcctggatgtagggttgtgcctgctgcccaagactgacctccagcaactcctgctc
ctgctgctggagagaatccaagagtggcctggaaagctccagcccctttgctgtgccctg
agctgggtgtccgaccaccaccacaacctgctggccctcgtgcagttcttcctggatgtg
acgcctcggggcaggcagctgagaagtcagctgagtcttgtgattattgcccggatgctg
ggccagcaggagtcacttcctttctcggcagagaaaacccagctagccctgctcagccag
ctcctcagcctcatgaggccttcgtccctcaggcagtgtctgggcattgaaaccttgcca
tccagtctagggcaacactcaaaggccagtgccgagctagactacaaggtctgctatctg
tgccacagcctcctgacactagctggggtcgtggtcagtagccaggacattactcccaat
caatggggtgagctacagctgttgtgcatgcagttggaccgtcatatcagcacccatatc
cgggagagccctcaggccatgcaccggaccaaactcaaggacctagctacccagacttac
atccgctggcaggacttgctggcccactgtcagccccagggtcagtacttcagcccttgg
aaagacatttaa

DBGET integrated database retrieval system