KEGG   Mus musculus (mouse): 381339Help
Entry
381339            CDS       T01002                                 

Gene name
Tmem182, 2310079P10Rik, AI414494
Definition
(RefSeq) transmembrane protein 182
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Claudin_2 PMP22_Claudin
Motif
Other DBs
NCBI-GeneID: 381339
NCBI-ProteinID: NP_001074667
MGI: 1923725
Ensembl: ENSMUSG00000079588
Vega: OTTMUSG00000042167
UniProt: B2RVY9
Position
1; 1 B
AA seq 229 aa AA seqDB search
MRLNVAVFFGALFGALGVLLFLVAFGSDYWLLATEVGRCSGEQNIENITFHHEGFFWRCW
FSGVVEENNSNIWKFWYTNQPPSKNCTHAYLSPYPFMRGEHNSTSYDSAIIYRGFWAVLL
LLGVVAALTASFLIICAAPFSSHFLYKAGGGSYIASGVLFSLVVILYVIWVQAVADMESY
RALRMRDCWEFTPSILYGWSFFLAPAGVFFSLLAGLLFLVVGRHIQIHH
NT seq 690 nt NT seq  +upstreamnt  +downstreamnt
atgagactaaacgttgccgttttctttggggctctcttcggagctttgggggttttgttg
tttttggtagcctttggatcggattattggcttctcgcgactgaagtgggcaggtgttca
ggtgaacagaatatagagaacatcacttttcaccatgaaggctttttctggaggtgctgg
ttcagtggcgttgtggaggagaacaactccaacatctggaagttctggtacaccaatcag
ccaccatccaagaactgcacacacgcttacctgtccccgtaccccttcatgaggggagag
cacaactccacctcctacgactccgcaattatttaccgtggcttctgggcagtcctgctg
ctcctgggggtagtggccgccttgactgcaagctttctgatcatctgtgcagcccccttt
tccagtcacttcctttataaagctggaggaggctcatacattgcctcaggtgtcctgttt
tccctggtggtgatactgtatgtcatctgggtccaggcagtggctgacatggaaagctac
agagccttgaggatgagagactgctgggaattcaccccttccatcctgtacggctggtcg
ttttttctggcccccgctggcgtattcttctctctgctcgctgggctgctctttctagtt
gttggacggcatatccagatacatcactaa

DBGET integrated database retrieval system