KEGG   Mus musculus (mouse): 381476
Entry
381476            CDS       T01002                                 

Gene name
Stpg2, B930007M17Rik, Gm1017
Definition
(RefSeq) sperm tail PG rich repeat containing 2
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: SHIPPO-rpt
Other DBs
NCBI-GeneID: 381476
NCBI-ProteinID: NP_941061
MGI: 2685863
Ensembl: ENSMUSG00000047940
Vega: OTTMUSG00000023362
UniProt: Q8C8J0
Position
3; 3 H1
AA seq 561 aa
MYDRAPRWLDCANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSLSSKTSACVVSSDAGQ
AVPGPAHYNVSQAQYNIRGGRSLQNREKRFKKLISDGPGPGSYNWPYLGTLCITTRQKTP
RTPAVSRNIDIPSIPSSGKSHGYHLNDDDTIMRRTPPPSDNTIGPAYYNPQFDYPKASLK
YKGVNFGNATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIKREQEHNYYTYVPRLYEAI
ILQEEKKGVPGPGKYNIKSEFDMIKSMSALVNSPSFIFFSETERFEPIKSCTPAPGTYNE
IRTAFKCPKKRFGLSLPFNQSAARFTEDSKAQKLPGPGFYDISTNIVKAQVKKPCLKKQP
KTGFGSSVPRTLFTAQKKAFRGPGPSDYQVRGTHDELPNLNKSAAFLSRAEKTPPVRKMR
LPAPGRYDVQKSYDMSQVKHKYMPPRTSVAKKRHSSFLSAAPRCLGKIADGPGPATYSPV
LMKSGAIISFVKGPKRFQEFHGEFSPGPTTYELSPFLRHSLLKRTYNVTLPCSSSPNREN
TGCPSQKATQKFQREKLQYFN
NT seq 1686 nt   +upstreamnt  +downstreamnt
atgtatgaccgtgctccgcgctggctcgactgtgccaaccgcggcagcaccgaggagcac
gtggggcctgggacctaccaggtaccttttcctaagcagcaggccacaggttgctatgca
ccatttctttctttgagttccaaaacaagtgcttgtgttgtctcctctgatgctggccaa
gctgttccaggtccagcacactacaacgtatcacaagcacagtataatataagaggaggc
cgcagtctgcaaaaccgagagaagcgatttaagaaacttatttcggatggtccaggacct
gggagctacaattggccttatcttgggacattatgtatcacaaccagacagaaaactcct
agaactcctgcagtttccagaaacattgatattccttcaatcccctcttccggaaagtca
catgggtatcatctcaatgacgatgacactattatgagacgcaccccacctcctagtgac
aacacaataggtccagcgtactacaatcctcagtttgattatcctaaagcatctttgaaa
tataaaggcgtaaattttggcaatgctacaggaagacaagaatttctcaagtattcgggt
cctggtcctggacagtatgatatcatccagaaaaggaaactacattgtgaaaatattaac
atcaagagagaacaagagcataattattatacatatgtcccacggctatatgaagcgata
atattgcaggaggaaaaaaagggtgtaccaggacctggaaagtacaacattaaaagtgaa
tttgacatgataaaatccatgtcagcacttgtgaattctccatcttttattttcttttct
gaaacagagagatttgaacctataaaatcatgcaccccagctcctggcacatacaatgaa
atacgaactgctttcaagtgcccaaagaaaagatttggactgtctttgccatttaaccag
agtgctgctcgattcacagaagattccaaggcacagaagctaccaggtcctggcttttat
gatatctcaaccaacattgtaaaagcccaggttaaaaaaccctgcttgaagaaacaaccg
aaaactggatttggttcttctgtgcctcgaactttgttcacagctcagaaaaaagctttc
cgtggtcctgggcctagtgattatcaggttcgaggaactcatgatgaattacctaacttg
aacaaatctgctgctttcttgtcgagagcagaaaaaactccaccagtacgaaaaatgcgt
cttccagctcctggccgctatgatgttcagaaatcgtatgacatgtcccaagttaaacat
aagtacatgccacctcgtacttcggtggctaaaaaaaggcattcctctttcctgagcgca
gctcctcggtgcctgggaaaaatcgctgatgggccaggacctgcaacatacagtcctgtt
ttaatgaagtctggtgccataatctcattcgttaaaggaccaaagcgttttcaagagttt
catggcgagttttctccaggccctacgacatatgagctcagtccatttctaagacattct
cttctgaagagaacatacaatgtcactctgccgtgttcatcctctcctaatagagaaaat
actggttgtccatcacaaaaagccacacaaaaatttcaaagagagaaattacagtatttt
aactga

DBGET integrated database retrieval system