KEGG   Mus musculus (house mouse): 381493
Entry
381493            CDS       T01002                                 
Symbol
S100a7a, Gm1020, S100A7L1, S100A7f, S100a15, S100a15a, S100a17l1
Name
(RefSeq) S100 calcium binding protein A7A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: S_100 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 381493
NCBI-ProteinID: NP_955454
MGI: 2687194
Ensembl: ENSMUSG00000063767
UniProt: Q6S5I3
Position
3:90561609..90565437
AA seq 108 aa
MPDTPVEDSLFQIIHCFHHYAAREGDKETLSLEELKALLLDSVPRFMDTLGRRQPYYITE
LFRAADKNKDNQICFDEFLYILGKLVKDYHLQFHRQLCAHYCTEHSLY
NT seq 327 nt   +upstreamnt  +downstreamnt
atgccagacacaccagtggaggactccctcttccaaatcatacactgcttccatcactat
gctgcccgggaaggggacaaggagaccttgtccctggaggagttgaaagctctgctcttg
gatagtgtgcctcgcttcatggacaccttgggccgcaggcagccatactacatcacagag
ctgttccgggcagctgacaaaaacaaggacaaccagatctgctttgatgagttcctgtac
atcttgggcaagctggtgaaggactaccatctccagttccaccggcagttgtgtgcacac
tactgtactgagcacagcctctactag

DBGET integrated database retrieval system