KEGG   Mus musculus (mouse): 381510Help
Entry
381510            CDS       T01002                                 

Gene name
Dpy19l4, Gm1023, Narg3
Definition
(RefSeq) dpy-19-like 4 (C. elegans)
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Dpy19
Motif
Other DBs
NCBI-GeneID: 381510
NCBI-ProteinID: NP_001074670
MGI: 2685869
Ensembl: ENSMUSG00000045205
Vega: OTTMUSG00000004592
UniProt: A2AJQ3
Position
4 A1; 4
AA seq 722 aa AA seqDB search
MAKEEGTSVEPRQRKKQRTSGSQEAKAEKIRRTPAPERAPKYVSFQRFAKIVIGCLAAVI
SGMMHVFYLSAYHERKFWFSNRQELEREITFQGDSAIYYSYYKDMLKAPSFERGVYELTH
NNKTISLKTINAMQQMSLYPELIASVLYQATGSNEVIEPVYFYIGIVFGLQGMYVTALFV
TSWLMSGTWLAGMLTVAWFLINRVDTTRIEYSIPLRENWALPYFACQVAALTGYLKRNLN
TYAERFCYLLLSTSTYTFMMVWEYSHYVLFLQAVSLLLLDIFSVEQSDKVYEVYKVYIFS
LFLGYLLQFENPALLVSPLLSLVGAFMLVKCLQLNGKKGTFVAKVIKVFEFYLLCTLPVT
LNLIVKMFVPHKENEHVLKFLEVKFGLNMTKNFTLNWLLCQESLQAPSQDFFFRLTQSSL
LPFYVLVLIICLLSMTQVFFRRMSGKSKKETVTLEDGRIGERPEIIYHVIHTLLLGSLAM
LMEGLKFIWTPYVCMLAAFGVCSPELWMTLLKWLRLRTVHPMLLALILSMAVPTIIGLSL
WKEFFPRLITELTELQEFYDPDTVELMTWIKRQAPVAAVFAGSPQLMGVIKLCTGWTVTS
LPLYSDDDLLQRNENIYQIYSKRSAEDIYKILTSYKANYLIVEDAICNELGTTRGCRVKD
LLDIANGHVVFEEGDKLTYSKYGRFCHEVKINYSPYVNYFTRVYWNRSYFVYKVNTVISF
QS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggaagaaggaacatctgtagaaccccgccaaaggaaaaagcaaagaacttca
ggaagtcaggaagccaaagcagagaagatccgcagaaccccagctcctgaaagagctcca
aaatatgtgtcatttcaacgttttgcaaagatcgtcattggctgtctcgcagccgttatt
agtggtatgatgcatgttttctacttgtcagcttaccatgaacggaaattctggttttcc
aacaggcaggagctcgagcgagagatcaccttccagggagacagcgctatttactactcc
tactataaagacatgctgaaggcgccgtcattcgagagaggtgtttatgagctgacgcac
aataacaaaaccatctccctgaagactatcaacgccatgcaacagatgtctttgtaccca
gaacttattgccagtgttctctatcaagcaactggcagcaatgaagtgatcgaaccagtg
tatttctacattggcattgtgtttggattacaaggaatgtatgtcacggctttgtttgtt
acaagttggcttatgagtggcacgtggctagcagggatgcttactgttgcgtggttccta
attaacagggtggacacaacaagaatcgagtactccattcctttaagagaaaactgggct
ctaccgtattttgcatgccaagttgctgcacttacaggctatttaaaaagaaatctaaat
acttatgcagagaggttttgctacctgttgctgagtacctcgacgtacactttcatgatg
gtgtgggagtacagccactacgtcttgtttcttcaggcagtatccctgctgctgctagat
atcttctcagtggaacaaagtgacaaggtttatgaagtatataaagtctacatattttct
ctcttccttgggtatttactacagtttgagaatccagctttattggtgtctcctttatta
agtttagtaggagcgttcatgcttgttaagtgccttcagctgaatgggaaaaaaggaact
tttgtggctaaagtaatcaaagtgtttgagttttacttgttatgtaccctgccggtgacc
ttgaatcttatagtgaagatgtttgtcccacacaaagaaaatgagcatgtgctgaaattt
cttgaagtcaaatttggactaaatatgactaagaatttcacactgaactggctcctttgt
caagagtctctccaggcgccgtcccaggatttttttttccgattgacccaatcttccctg
ttgccattctatgttttagtgttaattatttgtcttctttctatgacacaagtctttttt
agaaggatgagtggtaagtctaagaaagaaactgtaactcttgaagacggaagaattgga
gaaaggccagaaataatttatcatgtaattcacactctgttgctgggctctcttgccatg
cttatggaaggcttgaaattcatttggactccttacgtgtgcatgttggccgcgtttggt
gtatgttcccccgaactttggatgacacttttaaagtggcttcgattaagaactgtacac
ccaatgttgttggctcttattctgagcatggcggtacccactattataggtcttagttta
tggaaagagttttttccacgattaattacagaattaacagaactacaggaattctatgat
ccagatacagtggaacttatgacctggataaagaggcaagctccagttgcagctgtgttc
gcaggaagcccacagttgatgggtgtgattaagctgtgtactgggtggacagtgacaagc
ctgccactttacagcgatgatgacctgctccagagaaatgaaaatatttaccaaatctat
tcaaagcgatctgctgaggatatttataaaatcctgacatcttataaagctaactaccta
attgtagaagatgccatctgcaatgagctgggaaccacgagaggctgtcgggttaaagac
ttactagatattgcaaatggacatgtggttttcgaagaaggtgacaaattaacctattca
aaatatggacgattttgtcatgaggtcaaaattaactattctccatatgtgaattacttc
actagagtatactggaacagatcctactttgtatataaagtcaacactgtgatttccttc
caatcttga

DBGET integrated database retrieval system