KEGG   Mus musculus (mouse): 381560
Entry
381560            CDS       T01002                                 

Symbol
Xkr8, 4931440N07Rik, AI597014, Gm1031, XRG8, mXkr8
Name
(RefSeq) X-linked Kx blood group related 8
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: XK-related
Other DBs
NCBI-GeneID: 381560
NCBI-ProteinID: NP_958756
MGI: 2685877
Ensembl: ENSMUSG00000037752
Vega: OTTMUSG00000009963
UniProt: Q8C0T0
Position
4:complement(132452212..132459916)
AA seq 401 aa
MPLSVHHHVALDVVVGLVSILSFLLDLVADLWAVVQYVLLGRYLWAALVLVLLGQASVLL
QLFSWLWLTADPTELHHSQLSRPFLALLHLLQLGYLYRCLHGMHQGLSMCYQEMPSECDL
AYADFLSLDISMLKLFESFLEATPQLTLVLAIVLQNGQAEYYQWFGISSSFLGISWALLD
YHRSLRTCLPSKPRLGRSSSAIYFLWNLLLLGPRICAIALFSAVFPYYVALHFFSLWLVL
LFWIWLQGTNFMPDSKGEWLYRVTMALILYFSWFNVSGGRTRGRAVIHLIFIFSDSVLLV
TTSWVTHGTWLPSGISLLMWVTIGGACFFLGLALRVIYYLWLHPSCSWDPDLVDGTLGLL
SPHRPPKLIYNRRATLLAENFFAKAKARAVLTEEVQLNGVL
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgcctctgtccgtgcaccaccatgtggccttagacgtggtcgtaggcctggtgagtatc
ttgtctttcctgctggatctggtcgctgacctgtgggccgttgtccagtacgtgctcctt
ggccgttatctgtgggccgcgctggtactggtcctgctgggccaagcttcggtgctgctg
cagctcttcagctggctctggctgacagctgatcccaccgagctgcaccattcgcagctc
tcgcgtcctttcctggctctgctgcacctgctgcagctcggctacctgtataggtgtttg
cacggaatgcatcaagggctgtccatgtgctaccaggagatgccatccgagtgtgacctg
gcctacgcagactttctctccctggacatcagcatgctgaagcttttcgagagcttcctg
gaggcgacgccacagctcacactggtgctggcaattgtattgcagaatggccaggcggaa
tactaccagtggtttggcatcagctcatcctttcttggcatctcgtgggcactgctggat
taccatcggtctctgcgtacctgtcttccctccaagccacgcctgggccggagttcctct
gctatctacttcctgtggaacctgctgctgctggggcccagaatctgtgccatcgccttg
ttctcagctgtcttcccctactatgtggccctgcatttcttcagcctgtggctggtactt
ttgttctggatctggcttcaaggcacaaattttatgcctgactccaaaggtgagtggctg
taccgggtgacaatggccctcatcctctatttctcctggttcaacgtgtctgggggccgc
actcgaggccgggccgtcatccacctgatcttcatcttcagtgacagtgttctgctggtc
accacctcctgggtgacacacggcacctggctgcccagtgggatctcattgctgatgtgg
gtgacaataggaggagcctgcttcttcctgggactggctttgcgtgtgatctactacctc
tggctgcaccctagctgcagctgggaccctgacctcgtggatgggaccctaggactcctt
tctccccatcgtcctcctaagctgatttataacaggcgtgccaccctgttagcagagaac
ttcttcgccaaggccaaagctcgggctgtcctgacagaggaggtgcagctgaatggagtc
ctctga

DBGET integrated database retrieval system