KEGG   Mus musculus (mouse): 381590Help
Entry
381590            CDS       T01002                                 

Definition
(RefSeq) expressed sequence C87499
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 381590
NCBI-ProteinID: NP_941065
MGI: 2140706
Ensembl: ENSMUSG00000038330
Vega: OTTMUSG00000007666
UniProt: Q3UX49
Position
4; 4 C4
AA seq 493 aa AA seqDB search
MICHQCPDQHDSLEEETMNAYSPPTLLQLARQKLLREEALAISALKDLPRELLPEMFEEA
FTDECTKTLRAMIPMWPFPCLPVGTLIKNPNLETLKAVLEGLDILLAPKVRSSRCKLRVL
NLRNEHHEFWRIWAGSHEDECLPQLTQKQPVENSPDCGVKKHLQVTTDFELMKGRLDESA
TYLLQWAEQRKDSIHLCCRKLQIQGLSKDAFIEIFKIIDANCVQELELSCIWEEELPFLN
PYLRQMKNLLTLKLDDITEVTMDGDDLFDEKKRRKLISQLFSFYCLQNLYVDGTFAEGNM
IECLRYLKKPLETLCLRYCFLSQTDLDYLPHCLNICKLKHLSLSYIYLFNLFLEPLGILL
ERVRDTLQTLELQLCGLTDRHFSVLLPALSQCSHLTKINFYENTISLPVLKQLLYHTANL
SQLTQEQYPAPQECYDNMRGVETHRLGNICTELLDILRAKRQPERVAFATSRCIKCRGFL
VYDLETQRCFFQH
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtcaccagtgtcccgatcagcatgactctttagaagaggaaacaatgaatgcc
tactccccacccaccctcctgcagctggcaaggcagaagctactgagggaggaggccttg
gccatttctgctctcaaggacctacccagagagctgctaccagagatgtttgaggaggcc
ttcactgatgaatgtacaaagaccttaagggccatgatacctatgtggcccttcccatgc
cttcctgtaggaacgctgataaagaaccccaacctggagactttgaaggctgtgcttgag
ggactagatatactgcttgcaccaaaggttcgctccagtaggtgcaaactcagagtactc
aatttgaggaatgagcaccatgagttttggaggatatgggctggatcccatgaagatgaa
tgcttaccacagttgacacagaagcagccagtggagaatagtcctgactgtggagtgaag
aaacatttgcaggtgacaactgacttcgaactcatgaagggcagacttgatgaatctgct
acatacttgttgcagtgggctgagcagagaaaagattccattcatttatgctgtagaaag
ctgcagattcagggcttatccaaagacgcattcatagaaatcttcaaaattatagatgca
aactgtgtgcaggagctggagctaagttgtatctgggaagaagagttgccttttcttaat
ccctacctgagacagatgaaaaatcttctcactctcaagctagatgacatcacagaagtt
actatggatggtgatgatttgtttgacgagaagaaaaggcgcaagttgatttctcagctt
ttctcattctactgtctccagaatctctatgtagatggtacctttgcagaaggaaatatg
atagaatgcctcaggtacctgaagaagcccttggagactttgtgcctccgatactgtttt
ctctcacagacggacttggattacctgcctcattgcctgaatatttgtaagctcaaacat
ctgagcctgagttatatatatttatttaatttattccttgagcctcttgggattcttctt
gagagagttagagataccctgcaaaccctggaattgcaattatgtgggttgacggaccgt
catttcagtgtcctcctgcctgccttaagccaatgctcccacctcacaaagatcaatttc
tatgaaaataccatctctctacctgttctgaaacaacttttgtaccacacagccaacctg
agccagctgactcaggaacagtaccctgcccctcaggagtgctatgataacatgcgtgga
gttgaaacacacagattgggaaacatatgcactgagcttctggatatactcagggccaaa
agacagcccgagagagttgcctttgctacatcccgttgcattaaatgtcgtggcttcttg
gtctatgatctggagacccaacgttgctttttccagcactaa

DBGET integrated database retrieval system