KEGG   Mus musculus (mouse): 381628Help
Entry
381628            CDS       T01002                                 

Gene name
Adgrf3, Gm1041, Gpr113, Pgr23
Definition
(RefSeq) adhesion G protein-coupled receptor F3
  KO
K08456  adhesion G-protein coupled receptor F3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    381628 (Adgrf3)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    381628 (Adgrf3)
Peptidases [BR:mmu01002]
 Mixed Peptidases
  Family P2
   381628 (Adgrf3)
G protein-coupled receptors [BR:mmu04030]
 Adhesion receptor family
  Others
   381628 (Adgrf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 GPS HRM GAIN cEGF
Motif
Other DBs
NCBI-GeneID: 381628
NCBI-ProteinID: NP_001014416
MGI: 2685887
Ensembl: ENSMUSG00000067642
Vega: OTTMUSG00000024787
UniProt: Q58Y75
Position
5; 5 B1
AA seq 991 aa AA seqDB search
MSSLALSQLLLAVTLPLLELEPTFVPTAQSELSPYGGKSGQQLNQYSGEGESVLVSSYVH
LEFSSTAWPQELSKNFTLPTALAVLPPKTLTGLGLTTECRANHSGTSLCTCHPGYQWNAT
LCSLYPHCWGRRSERDSCMCRSFHGPVTGYCQLLPPVPANLILDSQLQMHGNTLNLILLK
KEEATNLRWFLRHSKNHTPISLWPGTNVLQTSSEGQSGLRVARMSRHWAGEYESIFEAQG
FRWRLRQLVKVPLQEEEVVRLPDALSISCTASTGFQLSCCIPLTTDYTATWSPGEDSQAS
LQKMSDSQCFVLAVPHCPATNTTYTCTLQSQNLPPLVAPVSITIIQDGDTTCPEDFSVVS
WNVTKAGFVAQAPCPVNKKGVVKRLCGTDGIWRPVQNTCTEAKILTLCLKAKLLEGQGKP
YEEVPWILSELQEQVGVASTPSDLWEMLHTVTLLAKVVAETSTELTGSALKDLLTTTDKI
LDANISALWTLAQAQEPSMGSDFLKAVETLVHSLRPQQHPFSFSSANVLLQSQLLRHSSP
PGYQMSFSTWPLLQARIPWHSLAPLVHSGTNVSITSLVLQKLDYRLPSNYTQGLWNTPYT
TPGLILVVSITADGQAFTQAEVIMDYEDMNGTLHCVFWDHRVFQGQGGWSDEGCEVHAAN
ASITQCICQHLTAFSILMSQHTVPENPTLDLLSQVGTGASVLALLVCLAIYGLVWRVVVR
NKVAFFRHTTLFNMVICLLVADTCFLGSPFLPSGYHSLICLVTAFLCHFFYLATFFWMLA
QALVLAHQLLFVFHQLSKHVVLSLMVMLGYLCPLGFAGVTLGLYLPQRKYLWEGKCFLNG
GGVMLYSFSEPVLAIVGVNGLVLVIAVLKLLRPSLSEGPTVEKRQALVGVLKALLILTPI
FGLTWGLGVATLFDGSIVSHYAFSILNSLQGVFILVFGCLTDKKVLEALRKRLRGSRSSN
SAISMVTNETYTSEHSKERSEPASYEERMTD
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctctagctctctcccagctgctcctggccgtgactcttcccctgctggagttg
gagccaacatttgtccccacagcccaatcagagctcagtccatatggagggaaatctggg
cagcaactgaaccagtacagtggagaaggggaatcagtgctggtctccagctatgtgcat
ctggaattttcaagcacagcctggccacaggagctctctaaaaactttactcttcctacc
gccctggcagtccttcccccgaaaacgcttactggccttggccttacaacagagtgtcgt
gctaaccacagcggaaccagcctctgcacttgccaccctggctaccaatggaatgccaca
ctttgttccctttacccacactgctggggccgcaggtcagaaagagattcctgtatgtgt
cgcagcttccacggtcctgttactggctactgccagttgctgccacctgttcctgcaaac
ctgatactggactcccagctgcaaatgcacggcaacaccctgaacctcattctcctcaag
aaagaggaagccacaaacctgagatggttcttgagacactcaaagaaccacacacccatc
agcctatggccagggaccaatgtgttgcagacgtccagtgagggccagtctggccttcgt
gtcgcccgcatgtcccgtcattgggcaggtgagtacgagagcatcttcgaagcccagggg
ttcaggtggaggctgcggcagctggtgaaggtgcccttgcaggaggaagaagtcgttcga
ctcccagacgccctgtccatctcctgtactgcctccactggctttcagctgagctgctgc
atcccacttacaacagactacactgctacctggagtcctggggaggacagccaagcctcc
ttgcaaaaaatgtcggattcccaatgctttgtgctagctgttccgcactgcccagcaacc
aataccacatacacctgtacccttcagagtcagaacctgcctcctctcgtggctcctgtc
tctatcacgattatccaggatggagacactacctgccctgaggacttctcagtggttagc
tggaatgtcaccaaggctggcttcgtggcacaggccccatgtcctgtgaataagaaaggt
gtggtaaagaggctctgtgggactgatggcatctggaggccagtccagaacacctgcaca
gaagcaaagatcctaaccttgtgtcttaaagccaagctgctggaaggccagggaaagccc
tacgaggaagtgccatggatcttgagtgagctgcaagagcaggtgggcgtggccagcacc
ccctctgacttatgggaaatgctgcacactgtgaccttactggccaaggtggtagcagag
acaagcacagagctcacaggcagtgctctgaaggacctcctgacgaccacagacaagatt
ctagacgcgaacatcagcgctctgtggactctggcccaggcccaggagccctccatgggc
tcagatttcctgaaggctgtggagaccttggttcacagcttaagaccacaacagcatcct
ttttccttcagctcagctaatgtgctactgcagagccagctcctcagacactcctctcct
cctggctaccaaatgtccttctccacctggcccctgctgcaggcacggattccatggcat
tcactggccccactggtccatagtggaactaacgtcagtattactagcctagtactgcaa
aagctggactaccggctgccctcaaactacacacaagggctgtggaacaccccatacacc
acccctgggctgatccttgtggtctccataacagcagacggccaggccttcacgcaggca
gaagttatcatggactatgaagacatgaatggaacccttcactgtgtgttctgggaccac
agggtcttccagggtcagggaggttggtcagatgaagggtgtgaggtacatgcagccaat
gccagcatcactcagtgcatttgccagcatctcacagccttttccatcctcatgtcccaa
cacactgtcccagaaaatcccaccctggacctgctgagccaggtgggtacgggggcttcc
gtcctggctttgctcgtctgcctggctatttacgggctggtgtggagagtggtggtccgg
aacaaagtcgccttcttccgccataccaccctgtttaacatggtgatctgcttgctggtc
gcagacacatgcttcttgggaagccccttccttccttcaggctaccacagcctgatctgc
ctagtcactgctttcctgtgtcactttttctacctggccacctttttctggatgctggca
caggccctggtgctggcccaccagctgctttttgtcttccaccagctgtccaagcacgta
gtcctctcactgatggtgatgctgggctacctgtgcccactggggtttgcgggtgtcacc
ctgggcctctacttgcctcaaaggaaatacctgtgggaggggaaatgctttctgaacgga
ggtggcgtcatgctgtacagcttcagtgagccagtgctggccatcgtcggtgtcaacggg
ctggtccttgtcatcgctgtgctgaagctgctgcgaccttcactgtcagaggggcccaca
gtggagaagcgccaagctcttgtgggggtgcttaaagccctgcttattctcacacccatc
tttggcctcacttggggactgggcgtggccactctgtttgatggctccatagtctctcac
tacgccttttccattctcaacagcctccagggtgtcttcatattagtgtttggctgcctc
acagacaagaaggtactagaggccttgcgcaaacgattgcgaggcagccggtcctctaac
tctgccatctccatggtcacaaatgaaacctatacctcagaacacagcaaagaaagaagt
gagcctgccagttatgaagaaaggatgactgattga

DBGET integrated database retrieval system