KEGG   Mus musculus (mouse): 381629
Entry
381629            CDS       T01002                                 

Gene name
Atraid, 0610007C21Rik, AI316792, Apr3, HSPC0, HSPC013, p1, p18
Definition
(RefSeq) all-trans retinoic acid induced differentiation factor
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: hEGF
Other DBs
NCBI-GeneID: 381629
NCBI-ProteinID: NP_082131
MGI: 1918918
Ensembl: ENSMUSG00000013622
Vega: OTTMUSG00000022387
UniProt: Q6PGD0 A8C1S6
Position
5; 5 B1
AA seq 223 aa
MASRESGGSRAAALLLVLGVERALALPEICTLCPGGMHNLSRVAAYCEDTSKLMQARCCL
NQKGTILGLDLQNCSLKDPGPNFLQAYTAIIIDLQANPLKDDLANTFRGFTQLQTLILPQ
DVPCPGGSNAWDNVTSFKDKQICQGQRDLCNSTGSPEMCPENGSCASDGPGLLQCVCADG
FHGYKCMRQGSFSLLMFFGILGSTTLAISILLWGTQRRKAKAS
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcgtctcgggagtcaggcggctctcgggcggccgccctgctcctggttctgggcgtg
gagagggccctggctctacctgagatatgcaccctgtgtccgggaggtatgcacaatttg
tccagagtggctgcttactgtgaggatacatcgaagctaatgcaggcccgatgctgcctg
aatcagaagggcaccatcttggggctagatcttcagaactgttccctgaaggatcctggt
ccaaactttttacaggcttatactgctattatcatagaccttcaggcaaatcctctcaag
gatgatttggccaacaccttccgtgggtttactcagctgcagactctgatactaccacaa
gatgttccctgtcctggaggtagtaatgcctgggacaatgttacttctttcaaggacaag
cagatttgccaagggcaaagggacctttgcaatagcactggaagcccagaaatgtgtcct
gagaacggatcttgtgcatctgacggtcctggtcttttgcagtgcgtttgtgctgatggt
ttccatggatacaagtgtatgaggcagggctcattttcactgcttatgttctttgggatt
ctgggatccaccacgctagccatctccattctactttggggaacccagcgccggaaagcc
aaggcttcatga

DBGET integrated database retrieval system