KEGG   Mus musculus (house mouse): 381678
Entry
381678            CDS       T01002                                 
Symbol
Zcwpw1, Gm1053
Name
(RefSeq) zinc finger, CW type with PWWP domain 1
  KO
K24688  zinc finger CW-type PWWP domain protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    381678 (Zcwpw1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    381678 (Zcwpw1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   Other histone modification proteins
    381678 (Zcwpw1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   Other DSBR factors
    Others
     381678 (Zcwpw1)
SSDB
Motif
Pfam: PWWP zf-CW
Other DBs
NCBI-GeneID: 381678
NCBI-ProteinID: NP_001005426
MGI: 2685899
Ensembl: ENSMUSG00000037108
UniProt: Q6IR42
Position
5:137785593..137820883
AA seq 630 aa
MMAALQTHKEYEKGTKKTFAPPTQKLHSEKPQPSSWKEDAPGTSSPEAETKPSLLKASLK
KEQKPTTEHGPNRGQERKLKAQDQPAKKKGKERTLTSAEFEEIFQIVLQKSLQECLETSS
CVQHIRPTKLDEEPGIVPPATDKKDADPEKVITPDTPKIASSLEEEVNSEMGTSKLGQPV
TEPSKKKFNRLSLSKQKKKAEDEKMEKIQDGRECSLKEKQKIVIQDQSQIRGPQKEEESG
FGHCVIWVQCSSPKCEKWRQLRGNIDPSVLPDDWSCDQNPDPNYNRCDIPEESWAGCESD
VAYASYVPGSIIWAKQYGYPWWPGMIEADPDLGEYFLFASHLDSLPSKYHVTFFGETVSR
AWIPVRMLKNFQELSLELVKKCKNKNSNQKLEAAIAMAHRAEQTSIQERVNLFGFWSRYN
GADISEEGEDLTLCESNNPESCLEKEEKDLEEEKEEEEEKKDPTLPRPKPAKMQTKKPKS
RGPAGGPDGTPKKKTAKKSLVSESTVPPVPTLGGKEEQGNSDLDHPVPKKKFKAPENKTS
ATNLSEEKEIKIVSKCPTPSAQHGACPLGKEGLVPHMPPTQEAASFPPDDDCSSDLDLEQ
LMEDIGEPEERGEMQQRGSSEEFLAALFEE
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgatggcagcattacagactcacaaagaatacgaaaagggaacaaagaaaacctttgct
ccacctacacaaaaattacatagcgagaaacctcagcccagctcatggaaggaggacgcc
ccagggaccagttctccagaggcagagaccaagccaagcctgctcaaagccagcttaaag
aaggagcagaaaccaaccacagagcatggtccaaacaggggccaggagagaaagctaaag
gctcaggaccagccagccaagaagaaaggaaaggaaagaactcttaccagtgcagaattt
gaggagattttccagattgtactacagaagtccctgcaggagtgcttggagacttcttcc
tgtgtccaacacatcagacctaccaaattggatgaagaaccgggcattgttcctcctgca
actgataagaaagatgctgatccagagaaggtaataactcctgatactccaaagattgca
tcttctttagaagaggaagtgaattctgagatggggacatctaagctaggccagccagtt
actgaaccctctaagaagaaatttaatagactctctttaagcaaacaaaagaagaaagct
gaagatgagaaaatggagaagatccaagatggccgtgagtgcagtctgaaggagaaacag
aagatagtgattcaggatcagtctcagatcagaggtccccagaaggaagaggagagtggt
tttggccactgtgtcatctgggttcagtgttcctctccaaagtgtgagaagtggcggcag
ctacgtggaaacattgatccctcagttcttccagacgactggtcttgtgaccagaatcca
gatccgaattataatcgctgtgacattcctgaggagagctgggcagggtgcgagagtgat
gtggcctatgcctcctatgtcccaggatccatcatctgggccaagcaatatggctaccca
tggtggccaggcatgatagaagctgatcctgacctgggggagtactttctgtttgcttct
catcttgattccctgccgtctaagtaccacgtgacattttttggagaaacggtttctcgt
gcatggatcccagtccgcatgttaaagaacttccaggagctgtctttggagctagtgaaa
aaatgcaagaacaagaactctaatcagaagctggaggcagccatagcgatggctcacagg
gcagaacagaccagtattcaggagcgggttaacttgtttggtttctggagtcgatacaat
ggagctgacatcagtgaggaaggggaagatttgactctctgtgagtccaacaaccctgag
tcttgtctggagaaggaagagaaggacttagaggaggagaaggaggaggaagaagagaag
aaagatccaactttgcctagacccaagccagctaaaatgcagacaaaaaagcccaagtca
agaggcccagctggaggaccagatgggactccaaagaagaagactgcgaagaaatctctg
gtcagtgaatccacagtccctcctgtacccacactgggagggaaggaagagcaggggaac
tcagacctggaccatccagtccctaagaaaaaatttaaagctcctgagaacaagacttca
gccaccaacttatctgaggagaaagaaattaaaattgtgtccaaatgccctactccatca
gctcagcatggggcttgtccattgggaaaggaagggcttgtgccccacatgcccccgaca
caggaggcagcaagtttccctcctgacgatgattgctccagtgacctggacttggagcaa
ctcatggaagacattggagagccagaagagagaggggagatgcagcagagaggcagctca
gaggagttcctggcggccctctttgaggagtag

DBGET integrated database retrieval system