KEGG   Mus musculus (house mouse): 381716
Entry
381716            CDS       T01002                                 
Symbol
Pttg1ip2, 1700015F17Rik, Gm1686
Name
(RefSeq) PTTG1IP family member 2
  KO
K26099  PTTG1-interacting protein
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    381716 (Pttg1ip2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Securin and associated proteins
    381716 (Pttg1ip2)
SSDB
Motif
Pfam: PSI
Other DBs
NCBI-GeneID: 381716
NCBI-ProteinID: NP_001186954
MGI: 2686532
Ensembl: ENSMUSG00000079666
UniProt: D3YUK8
Position
5:complement(5487827..5529143)
AA seq 150 aa
MCWLRAWSHILLPVFLSVALIQLIFNLSDHKTKTHHHWKRKIEAKYVEKECAQKETCPVC
TRDKRCIWCREEKVCKKYCFPYSDCKFNSIFWANCNVDLFGIVMLILIVILALAFLWYCL
AYYFYMQQHMALYARHGQVPVYNWDAPGDW
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtgctggctgagggcatggagccacatcctcctgcccgttttcctctctgtagctctc
atccagctgattttcaacttatctgaccataagactaaaacccaccatcactggaagcgg
aaaatcgaagcaaaatacgttgaaaaggaatgtgctcaaaaggaaacatgtccagtgtgt
actcgagataagagatgtatttggtgccgagaagaaaaggtttgcaaaaagtactgtttt
ccatattctgattgtaaattcaattctatattttgggcaaactgtaatgttgacctgttt
ggaatcgtgatgctgatactgattgtaatattagcactagcattcctctggtattgcctc
gcctattacttctacatgcaacagcatatggccctttatgcaagacatggacaagttccc
gtctacaactgggatgctccaggtgactggtga

DBGET integrated database retrieval system