KEGG   Mus musculus (mouse): 381760
Entry
381760            CDS       T01002                                 

Gene name
Ssbp1, 2810480P10Rik, G630031O20Rik, MtSSB, mtDB, mtDBP
Definition
(RefSeq) single-stranded DNA binding protein 1
  KO
K03111  single-strand DNA-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
mmu03430  Mismatch repair
mmu03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    381760 (Ssbp1)
   03430 Mismatch repair
    381760 (Ssbp1)
   03440 Homologous recombination
    381760 (Ssbp1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    381760 (Ssbp1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    381760 (Ssbp1)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    381760 (Ssbp1)
DNA replication proteins [BR:mmu03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    381760 (Ssbp1)
DNA repair and recombination proteins [BR:mmu03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     381760 (Ssbp1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    381760 (Ssbp1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    381760 (Ssbp1)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-GeneID: 381760
NCBI-ProteinID: NP_082634
MGI: 1920040
Ensembl: ENSMUSG00000029911
Vega: OTTMUSG00000026906
UniProt: Q9CYR0
Position
6; 6 B1
AA seq 152 aa
MFRRPVLQVFRQFVRHESEVASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLA
TNEMWRSGDSEVYQMGDVSQKTTWHRISVFRPGLRDVAYQYVKKGARIFVEGKVDYGEYM
DKNNVRRQATTIIAGKKLVVHSVSGCSLEGLA
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtttcgaagacctgtgttacaggtatttcgtcagtttgtaagacatgagtctgaagta
gccagcagtttggttcttgaacgatctctgaatcgtgttcagttacttggacgagtaggt
caggaccctgtcatgagacaggtggaaggaaaaaacccagtcacaatattttctctagca
acaaatgagatgtggcgatcaggggatagtgaagtataccaaatgggtgacgttagtcag
aagacgacgtggcacagaatatcagtgtttcgaccaggcctcagagatgtggcatatcag
tatgtgaaaaagggggctcgtatatttgtggaagggaaagtggactatggcgagtacatg
gataaaaacaatgtgaggcggcaagcaacaacaatcatagctggtaagaagctcgtggtg
cacagtgtctctggttgttcattggaagggttggcgtag

DBGET integrated database retrieval system