KEGG   Mus musculus (mouse): 381813Help
Entry
381813            CDS       T01002                                 

Gene name
Prmt8, Hrmt1l3, Hrmt1l4
Definition
(RefSeq) protein arginine N-methyltransferase 8
  KO
K11439  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    381813 (Prmt8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     381813 (Prmt8)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     381813 (Prmt8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PrmA Methyltransf_25 Methyltransf_11 Methyltransf_31 Met_10 Methyltransf_23 DOT1 Methyltransf_9 MTS Methyltransf_12 PCMT Methyltransf_16 Methyltransf_4 Methyltransf_18 PRMT5_C PRMT5 GidB
Motif
Other DBs
NCBI-GeneID: 381813
NCBI-ProteinID: NP_958759
MGI: 3043083
Ensembl: ENSMUSG00000030350
Vega: OTTMUSG00000020414
UniProt: Q6PAK3
Position
6; 6 F3
AA seq 394 aa AA seqDB search
MGMKHSSRCLLLRRKMAENAVESTEVSSAPPQPPQPVIPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgggcatgaaacactcctcccgctgcctgctcctccggaggaaaatggcggagaatgca
gtcgaaagcaccgaggtgagcagcgccccccctcagccccctcagcctgtcattccagcc
aagcctgtgcaatgtgtccaccatgtatccacacagcccagctgccctggacggggcaag
atgtccaagctgctgaaccccgaggagatgacatcgagagattactatttcgactcatac
gctcactttgggatccacgaggaaatgttgaaagacgaggtgaggacactcacgtaccgg
aactccatgtaccataataagcatgtgttcaaggacaaagtggtactggatgttgggagt
ggcacagggatcctttccatgtttgccgccaaagcaggggccaagaaggtgtttgggatt
gaatgttccagtatttctgactactcggagaagatcattaaggccaatcacctggacaat
gtcatcaccatatttaagggcaaagtggaggaggtggagctgcctgtggagaaggtggac
atcatcatcagcgagtggatgggctactgtctgttctacgagtccatgctcaacaccgtg
atctttgccagggacaagtggttgaaacctggagggcttatgtttccagaccgggcagct
ttgtacgtggtagcaatcgaagacagacagtacaaggacttcaaaatccactggtgggag
aatgtctatggctttgacatgacctgcatccgggatgttgccatgaaggagcccctggtg
gacatcgtggacccaaagcaagtggtgaccaatgcctgtttaataaaggaagtggacatt
tacactgtgaagacggaagagctgtccttcacgtctgccttctgcctgcagatccagcgc
aacgactatgtccatgccctcgtcacctattttaatattgaatttaccaagtgccacaag
aaaatgggtttttctacagcccctgatgccccctacacccactggaagcagactgtcttc
tacttagaagactacctcactgtccggagaggggaggaaatctacgggaccatatccatg
aagccaaatgccaaaaatgtgcgagacctcgatttcacagtagacttggattttaaggga
cagctgtgtgaaacatctgtatctaatgactacaaaatgcgttag

DBGET integrated database retrieval system