KEGG   Mus musculus (mouse): 381917
Entry
381917            CDS       T01002                                 

Symbol
Dnah3, BC051401, Dnahc3
Name
(RefSeq) dynein, axonemal, heavy chain 3
  KO
K10408  dynein axonemal heavy chain
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    381917 (Dnah3)
   05016 Huntington disease
    381917 (Dnah3)
   05022 Pathways of neurodegeneration - multiple diseases
    381917 (Dnah3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    381917 (Dnah3)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     381917 (Dnah3)
SSDB
Motif
Pfam: AAA_6 DHC_N2 Dynein_C AAA_8 AAA_9 AAA_7 AAA_lid_11 Dynein_heavy MT Dynein_AAA_lid AAA_5 AAA_lid_1 AAA AAA_16 ARL2_Bind_BART T2SSE Sigma54_activat
Other DBs
NCBI-GeneID: 381917
NCBI-ProteinID: NP_001357735
MGI: 2683040
Ensembl: ENSMUSG00000052273
Vega: OTTMUSG00000059177
Position
7; 7 F2
AA seq 4072 aa
MSDTNCSAQKLDKSDSVHHMSHSQARPELPPLPVSANEEPSELYKTVMSHSFYPPLMQRT
SWTLAVPFKEQDHHRGPSDSIGNNYSLTARDMKLKDLLKVYQPVTISIPRDKTSQGLPLA
FTASKTSTEPSKKKMKFNLKAKDDVTGMPFVCKFSSSLSIKNTTDSSVTHPESRPMSPEQ
QMDVMLQQEMEIESKEQKPSELDLERYYYYLTNGIRKDMIAPENEEVMMRIYKLIPKTLL
TTPALEPLQVSLRSEKESDYYYSLMKSIVDYILMDPMEKKRLFIKSIPRLFPHRVIRAPV
PWHNIYQSTKKWNEEHLHTVNPMMYKLKELWFAEFQNLRFVRTADLLAGKLPLLPHEYKE
VVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSL
QLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFFIPQLIMIKLEVRDPIIVFNPTFDD
CWQLIKNSFLEIIKNSDGIPKVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKK
NQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHIT
VPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPAN
TAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPNEDIKLNSNLFLWPDQI
EDVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEK
LHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSE
EWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLIDVPAPKRLAENVKLKIEKFKQHIPIL
NIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSL
EKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEA
ECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLM
AQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLE
ILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVE
KWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEALVE
DTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLND
FQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLG
GAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFN
RIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDN
LKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMR
AVKSVLTAAGNLKLKYPEENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPK
PDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLA
AALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSIT
DDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPAT
VSRCGMIYMEAHQLGWKPLKDSYMDTLPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKF
VVQTSPIHLAFSMMRLYSSLLDEIRDIQEEEMEIYEGLSSQQIFLWLQGLFLFSLVWTLA
GTINAESRKKFDVFFRNLIMGMDDRNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWN
AWTEYITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAIT
NDFLLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLN
MPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFT
RHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLP
TPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTF
FNLVKETTSNCFKQTMEKVLIHLSPTGKITDDNIRSLFFGDYLKPESDQKIYDEIIDLRG
LTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSAT
KLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVED
INMLLNTGDVPNIFPADEKADLVEKMQTAARTEGEKVEATPLSMYNFFIERVRKNLHIVL
AMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSM
CKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQ
KLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANA
AAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICV
MKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFI
DHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQ
KRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEA
ARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNT
LGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVI
KFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEY
SREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKL
ILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTE
TQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDL
RIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALD
NPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWPHEESLPSPW
FFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFI
LSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLA
TSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLL
RSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLR
ISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEIETDNY
HIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLT
LPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFN
RLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVAD
LLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTPKE
TTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDI
YVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN
NT seq 12219 nt   +upstreamnt  +downstreamnt
atgagcgacaccaattgctcagcgcagaagcttgacaagagtgactctgtacatcacatg
agccactcccaggcacggccagagctgccgcctctgcctgtgtctgccaatgaggagcca
tctgaactctataagactgtcatgtcacacagcttctatcccccactgatgcaacgcaca
tcctggaccctggctgtgcccttcaaagaacaggatcaccaccgtggacccagtgactct
attggcaataactattccttgacagctcgagacatgaagctgaaagacctgttgaaggtc
taccaaccagtcaccatcagtatccctagggacaagaccagtcaaggactgccattagca
ttcacagcatctaaaacctcaacagagccctccaagaaaaaaatgaagttcaacctcaaa
gccaaggatgatgttaccgggatgccgtttgtatgcaaattctcatcctccttgagcata
aagaacaccaccgactccagtgtgacccacccagaaagcagacccatgagtccagaacaa
cagatggatgtgatgttgcagcaggagatggaaatagaaagtaaagagcagaagccatct
gagttagacctggagagatattactactatttgaccaatggtatcagaaaagacatgatt
gccccggagaacgaggaggtgatgatgcgaatttacaaactgattcctaagacgctactg
acaactccagcccttgaaccccttcaagtctcacttaggtctgagaaggaaagtgactat
tactatagcctcatgaaaagcattgttgactacatcctcatggacccaatggaaaagaaa
aggctgttcatcaagagcatccctcgattgtttcctcacagagtgatccgggcccctgtg
ccctggcacaacatctaccagagtaccaagaagtggaatgaggagcatttgcacacagtg
aatcccatgatgtacaaactcaaagaactgtggtttgcagaatttcaaaacctcaggttt
gttcgaacagcagacttactggctggaaagttgcccttgctgcctcacgagtacaaggag
gtggtccagaagcactgccgggaggcgcgtcatattctactcaccaaatggatccccacc
tgtgcccagctttttgtgacccagaaggagcactgggttcacttcgctcccaagaatgac
tatgactcctctcggaacattgaggaatacttcgcttctgttgcttccttcatgtcccta
cagctccgagatttggtcattaagtccctcagggacctcgtttctttcttcatgatacat
aaggatggaaatgattttaaggagccttaccaagagatggacttcttcatacctcagcta
ataatgattaaacttgaagtgagagatcccattattgtcttcaacccaacttttgatgac
tgctggcaattaataaagaattccttcttggaaattattaagaattctgatgggatcccc
aaggtggaatctatactcttcccagatttgaaaggctacaacatgattcttggaactgtt
aaccctgaagaaagccttgtttcagattttttggatcagactttagaggtatttaagaaa
aatcaagttggaccttacaaatacttaaatgtatacaagaaatatgatgacttgctggac
aacatggcagagaagggcatcagtgaattcctgaaagaaaaacatgaaattgaggacttt
gtgacgagcatcaatagcataaaaaagaggaaaaatgaaattgcatccatgcacatcacc
gtgcctttggccatgttctgtcttgatgccgtgttcctaaattatgacctctgtgagcga
gcccaaaatcttaaagacaatttgattctgtatcaagtggatgtaaaccgggaaaccaat
accagcatttgcaatcagtacagcaccattgctgacaaagtcagtgagatccctgccaat
accgcggagctagtagcactcatcgaatatttaaagaaatccagtgatgtcactgtgttc
aagctcaggaggcaactcagagatgcaagtgaacggcttgagttcctgatggattatgca
gacttgcccaatgaagatatcaaactgaacagcaacctgttcctctggcctgaccagata
gaagatgtctttgaaagtagccgaaatctgctcatgagcaagagggatcaggcagagatg
gacctcattaaaaggtgctcagaatttgagtcgagacttgaaggctatagcaaagagctg
gaaatgtttaggaagcgtgaagtgatgactaccgaagaaatgaagaacaatgtggaaaag
cttcatgacctctccaagaacctagatctggcgctgacagaatttgagttgatcaacaag
gaggaagagctgctggagaaggagaagagctccttccctcttcttcaaaccctgatgatc
aacaaaatcccctacgagcagctgtgggtcacagcctatgagttcagcaccaagtcagag
gagtggatgaatggccccctctacttaatgaatgctgagcaaatcgcagaggagataggg
aatatgtggaggacaacctacaagttgaccaagaccttgatcgatgtgcctgcgcccaag
cgcttagcagagaatgtcaagttgaagattgagaagttcaagcagcatattcccatcctg
aatatcgcctgcaaccccgggatgaaggatcggcactggcaacagatcagtgacattgtt
ggctatgagataaagcccacagagaccacgtgcctcgccaatatgctggaatatggattc
ggcaaatttgttgataagctggagcccattggggcagctgccagcaaggagtattctctg
gagaaaaacttggagaagatgaaggcagactgggtcaatatgtgcttcagtttcgtgaag
tacagggacacggataccagcatcttgtgtgcagttgatgacattcaattaatactcgat
gatcatgtgataaagacccagactatgtgtggttccgtgttcatcaagccaatagaagca
gagtgccggaaatgggaagaaaagctagtgcgggtacaagaaaatttggatgcctggtta
aaatgccaagtaacttggttgtacctggaaccgatcttcagctccgaagatatcatagcc
cagatgccagaagagggcaagaaatttaccactgtggatacttactggaaatcactcatg
gcccaggcggtaaacgatacaagggtaatggtggcagctgaccagccaagaatgactgag
aagcttcaggaagccaatgttctattggaagacatccagcgggggctgaacgactacctg
gagaagaagaggctctttttccccaggttcttcttcctgtcaaatgatgagctcctggag
atcttgtcagagacaaaggacccactccgagtacagccacacttgaagaagtgcttcgaa
ggaattgccaaactggagtttacagacaatctggaaatcaagggcatgatcagctcagaa
aaagaaactgttccattcatacagacaatctatccagtgaaagccaagggcatggtggag
aagtggctgcagcaggtggagcaggtgatgttggccagcatgcggcaagttattgaaaat
gggattgaagcttatgtccaggtccctcgtaatgcctgggtcttggagtggccaggccag
gtagttatctgtgtctcctccatcttttggaccagagaagtgtctgaagccctagttgaa
gacacccttacagactttctgaaaaagagcaatgaccagatcgcacagatcgttgagctg
gttcgagggaagctgagcagtggggcgaggctcactctgggagccctcactgtcatcgat
gtccatgctcgtgatgtggtggccaaactgaggcatgatcatatcaacagtctaaatgac
ttccagtggatttcacagctacgatactattggacggaaaagaacgttcatgtgcaaatg
ataaccacagaagccttgtatggctacgagtacctgggaaactctccccggctagtgatc
actcctctcacagaccgctgctacaggaccctaatgggagctttgaagttgaaccttgga
ggtgctccagagggtccagctgggacaggcaagacagaaaccaccaaagatctggctaaa
gctttggccaagcagtgtgtggtcttcaattgttctgacggcttggattacaaagccatg
ggcaagttcttcaaggggctggctcaagctggagcatgggcctgttttgatgaattcaac
aggattgaggtggaagtactgtcagtggtagcccaacagattctcagcatccagcaagcc
attatcaggaagctgaagaggttcatctttgaaggcactgagctctcactgaacccaacc
tgtgctgtcttcatcaccatgaatcctgggtatgctggcagggctgagctgccagataac
ctcaaggccttattccgaacagtagccatgatggtgccagattatgctcttattggagaa
atctccctctattctatgggatttctggactccagaagtcttgcccagaagattgttgcc
acctaccgcctgtgctctgagcaactctcatctcaacatcactatgactatggcatgcgg
gctgtcaagtctgtgctcacagctgcaggcaatctgaagcttaagtaccctgaggagaat
gagagtgttctgttgctccgggccttgctggatgtcaacctggccaagttcttggctcaa
gatgtccccctgtttcagggcattatctcagatctgtttcctggagttgttcttccaaag
ccagactacgaagttttcctggaagcattgaacaacaacatcagaaaaatgaagctgcag
ccagtgccctggttcattgggaagattatccagatctatgagatgatgctggtaagacat
ggctacatgattgttggagatccaatgggtggcaagacatcagcttataaagttctggct
gcagctctgggtgatttacatgcagccaaccagatggaagagtttgctgtggagttcaag
atcatcaaccccaaggctatcacaatggggcaactgtatggctgctttgatgctgtgagc
catgagtggacagatggtgtcctggccaatgctttccgggaacaagcgtcttccataact
gatgaccgcaaatggattatatttgatggaccagtagatgctgtttggattgaaaatatg
aacactgtcctggatgacaataaaaagctgtgcttaatgagtggagagatcattcagatg
agctccaagatgagtctaatctttgagccagcagatctggagcaggcctcccccgccacc
gtgagcaggtgtgggatgatctacatggaggcccaccagctgggctggaagcccttgaag
gactcatacatggatactttgccccgctgtctcactaaggagcacacagaactggttgag
gacatgttcacgtggcttgtgcagccctgtctggactttagtcggctccattgcaaattt
gtggtgcaaacatctcccatccaccttgccttctcaatgatgcggctgtactcctccctg
ctggatgaaatccgggacatccaggaggaggaaatggagatatatgaaggtctgtcaagc
cagcagatcttcctctggctgcaaggcctgtttcttttctccttggtgtggactttggcg
ggtaccatcaatgctgagagcagaaagaaatttgatgtatttttccgcaacctgatcatg
ggcatggatgatcgtaacccaaggcccaagagtgtgaaactcaccaaaaacaacatcttc
ccagaaagaggaagcatctatgatttttacttcctcaaacaagggggtggacactggaat
gcatggacagaatatatcaccaaggaggaggagactattcctgcgaatgcaaaggtatca
gacctcatcattcccacaatggagactgcccggcagtccttcttcttaaaaacctacctg
gaccatgagatcccgatattgttcgtgggtcccacaggcactggcaaatcagctatcacc
aatgacttccttctccaccttcccaaaaatgtctaccagcccaacttcatcaacttctct
gccagaacttcagccaaccagacccaggatatcatcatgtccaagctggaccgtcggagg
aaaggcctttttgggcctcccatagggaagaaagcagttgtgtttgtagatgatctcaac
atgccagccaaagaggtgtatggagcccagccccccatcgagctgctgagacaatggatt
gaccatggctactggtttgacaagaaagacacaaacaggctggacattgtggatgttctg
cttgtgactgccatgggtccccctggtggaggaaggaatgacatcactggacgattcact
cgccatctgaatatcatttccatcaacgcctttgaagatgaaatcttaaccaaaattttc
agttctattgctgactggcattttgggaaagggtttgatgtcatgttcttacggtatggg
aagatgctggtccaagcaacccagacaatttacagagctgcagtggagaacttcttgcca
actccctccaaatcacattatgtctttaaccttcgggatttctcacgggtgatccaggga
gtactgctgtgtccccacacccacctacaggatttggaaaaatttatccggctttggatc
catgaggtttaccgagtcttttatgaccgcctgattgacaatgatgacagacagactttc
ttcaacctggtgaaggaaaccacctccaattgcttcaagcagaccatggagaaggtgctc
atccacctgtcacccaccgggaagataactgatgacaacatccgtagcctcttcttcggg
gattatttgaagccagaaagtgaccaaaaaatctatgacgagatcattgacctgagagga
ctcacggtggtgatggagtactatctggatgagttcaacagtgtcagcaaggcccccatg
tctttggtcatgttcaagtttgccattgagcacatctccaggatctgcagagtcctgaag
cagaagaaaggtcacttgctcctggtgggcattgggggcagtgggcggcagagcgccacc
aaactgtccacgttcatgaactcctatgagttataccagattgaaatcacaaagaattac
accaacagcgactggagagaggacctgaaaaagataatgttgcagtcaggagtggccacc
aagagtactgtgttcctcttctcggataaccagatcaagcatgagtcatttgtggaagac
atcaacatgcttctgaacacaggcgatgtgcccaacatcttcccagcagatgagaaggct
gacctcgtggaaaagatgcaaacagcggccaggacagaaggagagaaggttgaagccact
cccctgtctatgtacaatttctttatcgagagagtgagaaagaaccttcacattgttctt
gccatgagtccaatcggggatgccttcagaacccgcctgagaatgttcccgtcacttatc
aactgctgcaccattgattggttccagtcctggccaaccgatgccttagagttggtggcc
aacaaattcctggaggacgtggagcttgatgacaacattcgggcagaggtcgtctccatg
tgcaagtacttccaggagagcgtgaagaagctatcggttgactactacaacacacttctc
agacacaactatgtgacccccacctcttaccttgaattgatcctaaccttcaaaactctc
ctgaatagcaagagacaagaggtggacacaattaggaaccgctacttggcaggcttgcag
aaactggaatttgcatcttcacaagtggctgtcatgcaggtagagctcactgcccttcag
cctcagctcatccaaacctctgaggatacagcgatgatgatggtgaaaattgagctggag
acaaaagaagctgatgccaagaaacttctggtgcaggcagatgagaaggaggctaatgct
gctgctgccatctctcaggcgatcaagaatgagtgtgagggagacctggccgaggccatg
ccagcacttgaggctgcccttgctgccctcgacaccctgaacccatctgacatcacgctg
gtgaagtccatgcagaacccaccaggccctgtcaagctggttatggagagcatttgcgtc
atgaaggggctgaagccagagaggaagccagaccccagtggctccggtaaaatgatagaa
gattactggggagtgtcaagaaagatccttggagatctaaagttcttggaaagtctcaag
acatacgacaaagacaacatcccttcggtgatcatgaagcgaatccgggaaaggtttatt
gatcaccctgatttccagccagctgtcattaaaaatgtatcatctgcctgtgagggcctg
tgcaagtgggtgagggccatggaagtgtatgaccgagtggccaaggttgtggctcccaaa
cgggagcgactgagggaggctgaggggaagctggagatccaaatgcaaaaactgaaccag
aaacgggcggagctgaagctggtggaagaccgactccaagatctcaatgacgagtttgaa
ctgatgaacagaaagaaaaattcactggagaaaaatatagaaatctgctcccagaagctc
gtcagggcagagaagcttatcagtggccttggaggagagaaggacagatggacagaggct
gcccggcagctggggatccgctatgataacctgaccggggatgttttgctagcctctggg
accgtggcttacctgggtgccttcacggtggattatcgggcccaatgccaaaatgaatgg
ttggtttcctgtaaggacaaggtcatcccaggctccgttgattttagcctcagcaacacc
ttaggggaccccataaaaatccgtgcctggcagatagcagggcttcctgttgactccttc
tctgttgacaatggcatcattgtgtccaattccaggcgctggcctttgatgattgaccct
cagggacaggccaataagtgggtgaagaatatggaaaaaacaaacaagctatctgtcatc
aagttctctgataccaattacgtgaggactctggaaaatgccctgcagtttggcacccct
gtcttgttggaaaacgttggagaagagctggatgcctttattgaacccatcttgctgaag
gcaacattcaaacagcagggggtggagtacatgagactgggtgaaaatattattgaatac
tcaagggaatttaagttctatataaccactcgtctgaggaatccacattatctccctgaa
gttgccgtgaaagtctgtctcctcaacttcatgatcacacccttgggtctccaagatcaa
ctccttggcattgtggctgccaaggagaagccagagctagaagagaaaaagaacaagttg
attttagaaagtgcccagaataagaaacagctaaaggagattgaggataagattctagag
gtcctatccctgtgtgagggcaacatcctcgaagatgagacagccatcaaaattttgtcc
tcttcgaaagttctgtctgaggagatctctgagaagcaagaaatagcatctgtgacagaa
acccaaattgatgagacccgcatgggctacaagcctgtcgctgttcattctgcagccatc
tttttctgtatctccgacctagcccacattgagcctatgtaccagtattctctgacttgg
ttcatcaacctctacgtgcagtctctagcaaatagcaacaagagtgatgagctggattta
cggatcgagtacatcatcgaacatttcactctaagcatctacaacaacgtgtgccgctca
ctgtttgagaaggacaagctacttttctccctccttctgaccgttggcctcttgaaggaa
agaaaggcaattgatgaggaagtttggtacttccttttaactggaggtgtggccttggac
aatcctttccccaacccagctccagaatggttatcagagaagtcatggggtgagattgtt
cgagcttcctccttacagaaactaaagggtctgatggaagatgtcatgcaaaatatcaaa
gtatggaaggacatctatgactcagcctggccacatgaagagtcactaccttcaccttgg
tttttccttcaaacactggaaaagatagcaatccttcgatgtttgcggcccgacaagata
gtcccagccattcaaaacttcatctgtgaaaccatgggaaagatattcatcgaagcccca
acctttgatctccagggatcctacggtgattccagttgctgcgtaccattgattttcata
ctgtctccaggtgcagacccaatggcaggtctgctgaagtttgctgatgatgttagcatg
ggaggcactaaaacacagaccatctcccttggtcaaggccaaggtcctattgctgccaat
atgatcaacaaagccatccatgaagggacctgggtggtcctacagaactgccacctggct
acaagctggatgccagcgttagagaagatttgtgaggaggtgattgtccctgagaacacc
aactcagagttcaggctctggctaactagctatccatcagagaagtttcccgtcagcatt
ctccagaatgggatcaaaatgaccaacgagccccccaaaggacttagggccaaccttctg
cgttcctacctcaatgacccaatctcagaccctttgttcttccagagctgtacaaagcca
gttatatggcagaaactgttgtttgggctttgcttcttccatgccattgtccaggagagg
aggaactatggagccctaggttggaacatcccttatgaattcaatgaatctgacctgagg
attagcatgcggcagatccagatgttcctcaatgattacgaagaggtgcccttcgaggct
ctgacctacttgacaggtgaatgtaattatggaggcagagtgactgatgacaaagatagg
cgtctcctgctgtccctcctgtccatgttctactgtaaagaaattgaaacagataactat
cacattgctcctggagatgcttatgtcatccccccctatggctcctaccagtcttacatt
gagtatctcaggaccctccccatcacagcacaccctgaagtatttggtctccatgagaat
gctgacatcaccaaggacaaccaggaaaccaaccagctcttccaaggagtgctgctgacc
ctgccgagacagtccggagggagtgggaagtctcctcaggaagtggttgaggagctggcc
caggatatactctccaagcttcccaacgactttaacctggaggaggtaatgaagaagtac
cccgtggtctataaggagtctatgaacactgttctaaggcaggagctcatcagattcaac
aggctgaccaaagtggttcgcagaagccttattgatcttggccgagccatcaaaggacaa
gtcctaatgtcctcagagctggaggaagtcttcaatagtatgcttgtgggtaaagtgcca
gccatgtgggcagccaagtcctacccatcactgaagcccctggggggctacgtggctgac
ctattggcccgcctgaccttcttccaggaatggatcgacaaaggcccccctgtggtcttt
tggatctctggattctacttcacacagtcctttttgacgggagtttctcagaattatgcc
aggaaatacaccatccccattgaccacatcggatttgaatttgaggtaacaccaaaagaa
acgacaatggaaaatatcccagaagatggggcctacatcaaaggacttttccttgagggt
gcccgttgggacaggtcaacctcgcagattggagaatctctccccaaaatcctctatgac
ccattgcccattatttggctgaaacccggagagagtgcatcattcctgcatcaggacatt
tatgtgtgtccagtgtataagacgagtgctcggagaggtatcctctctaccactggccac
tctactaactacgtcctgtccattgagctaccaacagacatgccccaaaagcactggata
aaccgaggcgtggcctcactgtgccagctggataattga

DBGET integrated database retrieval system