KEGG   Mus musculus (house mouse): 381925
Entry
381925            CDS       T01002                                 
Symbol
Plpp4, C030048B12Rik, Gm1090, Ppapdc1a
Name
(RefSeq) phospholipid phosphatase 4
  KO
K18693  diacylglycerol diphosphate phosphatase / phosphatidate phosphatase [EC:3.6.1.75 3.1.3.4]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00561  Glycerolipid metabolism
mmu00564  Glycerophospholipid metabolism
Module
mmu_M00089  Triacylglycerol biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    381925 (Plpp4)
   00564 Glycerophospholipid metabolism
    381925 (Plpp4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.4  phosphatidate phosphatase
     381925 (Plpp4)
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.75  diacylglycerol diphosphate phosphatase
     381925 (Plpp4)
SSDB
Motif
Pfam: PAP2 DUF975
Other DBs
NCBI-GeneID: 381925
NCBI-ProteinID: NP_001074432
MGI: 2685936
Ensembl: ENSMUSG00000070366
UniProt: Q0VBU9
Position
7:128858114..128993138
AA seq 271 aa
MRELAIEIGVRALLFGVFVFTEFLDPFQRVIQPEEIWLYKNPLVQSDNIPTRLMFAISFL
TPLAVICVVKIIRRTDKTEIKEAFLAVSLALALNGVCTNTIKLIVGRPRPDFFYRCFPDG
VMNSEMRCTGDPDLVSEGRKSFPSIHSSFAFSGLGFTTFYLAGKLHCFTESGRGKSWRLC
AAILPLYCAMMIALSRMCDYKHHWQDSFVGGVIGLIFAYICYRQHYPPLANTACHKPYVS
LRVPTSLKKEERPTADSAPSLPLEGITEGPV
NT seq 816 nt   +upstreamnt  +downstreamnt
atgcgggagctggccatcgagatcggggtgcgagcccttctcttcggggtctttgttttt
acagaatttttggatccattccagagagtcatccagccggaagagatctggctctataaa
aatcctttggtgcagtcagacaacatacctacccgcctcatgtttgcaatttctttcctc
acacccttggctgttatttgcgtggtgaaaattatccggcggacagacaagactgaaatt
aaggaagccttcttagcagtgtccttggctcttgctttgaatggagtctgcacaaacact
attaaactaatagtgggaagacctcgccccgatttcttttaccgctgctttccagatggg
gtgatgaattcggagatgcgctgcacaggtgaccctgacctggtgtcggagggccgcaaa
agcttccccagcatccattcctcctttgccttctcgggcctcggtttcacaacattctac
ctggctggcaagctgcactgcttcaccgagagtgggcgggggaagagctggaggctctgt
gctgccatcttgcccttgtactgtgccatgatgatcgccctgtcccgcatgtgtgactac
aagcatcattggcaagattcttttgttggaggagtgattggcctcatttttgcctatatt
tgctacagacaacattatcctcctctggccaacacagcatgccacaaaccgtatgtcagc
cttcgagtgcccacttcactgaagaaggaagagaggcctacagccgacagtgcgcccagc
ttgcccctggaggggatcaccgagggccccgtatga

DBGET integrated database retrieval system