KEGG   Mus musculus (house mouse): 381983
Entry
381983            CDS       T01002                                 
Symbol
Lmtk3, aatyk3
Name
(RefSeq) lemur tyrosine kinase 3
  KO
K08899  lemur tyrosine kinase 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    381983 (Lmtk3)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    381983 (Lmtk3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     381983 (Lmtk3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  LMR family [OT]
   381983 (Lmtk3)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     381983 (Lmtk3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase
Other DBs
NCBI-GeneID: 381983
NCBI-ProteinID: NP_001005511
MGI: 3039582
Ensembl: ENSMUSG00000062044
UniProt: Q5XJV6 A0A0R4J0W7
Position
7:45432577..45456315
AA seq 1424 aa
MPAPGALILLAAVSASGCLASPAHPDGFALSRAPLAPPYAVVLISCSGLLAFIFLLLTCL
CCKRGDVRFKEFENPEGEDCSGEYTPPAEETSSSQSLPDVYILPLAEVSLPMPAPQPPHS
DISTPLGLSRQHLSYLQEIGSGWFGKVILGEVFSDYSPAQVVVKELRASAGPLEQRKFIS
EAQPYRSLQHPNVLQCLGVCVETLPFLLIMEFCQLGDLKRYLRAQRPPEGMSPELPPRDL
RTLQRMGLEIARGLAHLHSHNYVHSDLALRNCLLTSDLTVRIGDYGLAHSNYKEDYYLTP
ERLWVPLRWAAPELLGELHGSFVLVDQSRESNVWSLGVTLWELFEFGAQPYRHLSDEEVL
AFVVRQQHVKLARPRLKLPYADYWYDILQSCWRPPAQRPSASDLQLQLTYLLSERPPRPP
PPPPPPRDGPFPWPWPPSHSAPRPGTLSSQFPLLDGFPGADPDDVLTVTESSRGLNLECL
WEKARRGAGRGGGAPPWQPASAPPAPHTNPSNPFYEALSTPSVLPVISARSPSVSSEYYI
RLEEHGSPPEPLFPNDWDPLDPGVPGPQAPQTPSEVPQLVSETWASPLFPAPRPFPAQSS
GSGGFLLSGWDPEGRGAGETLAGDPAEVLGEQGTAPWAEEEEEESSPGEDSSSLGGGPSR
RGPLPCPLCSREGPCSCLPLERGDAVAGWGDHPALGCPHPPEDDSSLRAERGSLADLPLV
PPTSAPLEFLDPLMGAAAPQYPGRGPPPAPPPPPPPPRASAEPAASPDPPSALASPGSGL
SSPGPKPGDSGYETETPFSPEGAFPGGGAAEEEGVPRPRAPPEPPDPGAPRPPPDPGPLP
LPGSQEKPTFVVQVSTEQLLMSLREDVTKNLLGDKGSTPGETGPRKAGRSPANREKGPGP
NRDLTSLVSRKKVPSRSLPVNGVTVLENGKPGVPDMKEKVAENGLESPEKEERALVNGEP
MSPEAGEKVLANGVLMSPKSEEKVAENGVLRLPRNTERPPEIGPRRVPGPWEKTPETGGL
APETLLDRAPAPCEAALPQNGLEMAPGQLGPAPKSGNPDPGTEWRVHESGGAPRAPGAGK
LDLGSGGRALGGVGTAPAGGPASAVDAKAGWVDNSRPLPPPPQPLGAQQRRPEPVPLKAR
PEVAQEEEPGVPDNRLGGDMAPSVDEDPLKPERKGPEMPRLFLDLGPPQGNSEQIKAKLS
RLSLALPPLTLTPFPGPGPRRPPWEGADAGAAGGEAGGAGAPGPAEEDGEDEDEDEEDEE
AAGSRDPGRTREAPVPVVVSSADGDTVRPLRGLLKSPRAADEPEDSELERKRKMVSFHGD
VTVYLFDQETPTNELSVQGTPEGDTEPSTPPAPPTPPHPTTPGDGFPNSDSGFGGSFEWA
EDFPLLPPPGPPLCFSRFSVSPALETPGPPARAPDARPAGPVEN
NT seq 4275 nt   +upstreamnt  +downstreamnt
atgcctgcacccggcgcactcatcctcctggcggccgtctccgcctccggctgcctggcg
tccccagcgcacccggatggattcgctctgagccgggcccctttggctccgccctacgct
gtggtcctcatttcctgttcgggtctgctggccttcatctttctcctccttacctgtctg
tgttgcaaacggggtgatgttcgtttcaaggagtttgagaacccggaaggggaggactgc
tctggggagtacaccccccctgcggaggagacctcctcctcacagtcgctgcctgatgtc
tatattctgccgctggcagaggtctcactgccaatgcctgccccgcagcctccacactca
gacatcagcacccccctgggcctgagccgccagcacctcagctacctgcaggagattggc
agcggctggtttgggaaggtgatcctcggggaggttttctcagactactcgccagcccag
gtggtggtgaaggaactccgggctagtgccgggcccctggaacagcgcaagttcatctcc
gaggctcagccctacaggagcctgcagcatcccaacgtcctccagtgcctgggcgtctgt
gtggagaccttgcccttcctgttgatcatggagttctgccagctgggggacctgaagcga
taccttcgggcccagcggccacctgaaggcatgtcccctgaacttccccctcgagacctt
cggacactgcagaggatgggtctagagattgcccgaggactggcacacctgcactctcac
aactatgtgcacagcgatctggcgctgcgcaactgcctgctaacttcagacctgactgtg
cgtattggagactatgggctggcgcacagcaactacaaggaagactactacctgacaccc
gagcgcctatgggtgccgctgcgctgggcagcgcccgagctgctgggcgagctgcacggc
agcttcgtgctggtagatcaaagccgggagagtaatgtctggtccctgggggtgacactc
tgggagctattcgagttcggggcacagccctatcgtcacctatcggatgaggaggtcctg
gcctttgttgtccgccagcagcacgtgaagctggcccggcccaggctcaagctgccctac
gctgactattggtatgacattttgcagtcttgctggcggccgccagcccagcgcccctca
gcttctgatctccagctgcagctcacttacctgctgtctgagcggccccccaggccccct
cctccaccaccccctccccgagatgggcccttcccctggccctggcccccctcgcatagt
gcgccgcgcccagggaccctgtcctcccagttcccccttctggatggcttccccggggct
gaccctgatgatgtactcacagtcaccgagagcagccgtggcctcaaccttgagtgcctg
tgggagaaggcccgccgtggggcaggccggggtgggggtgcacctccctggcaacccgct
tctgcgcctcctgcgccccataccaatccatccaatcccttctatgaggcgctgtccacc
cctagcgtgcttccggtcatcagcgcacgcagtccctcggtgagcagcgagtactatatc
cgcctggaggagcacggttctccaccagagcccctcttccccaacgactgggacccgctg
gacccaggagtacccggtccccaggccccccagactccctccgaggtccctcagctggtg
tccgagacctgggcttcccccctcttccccgcgccccgacccttcccggcccagtcctcg
ggatcaggtggtttcctgctgagcggctgggaccccgagggccggggcgcaggagagacc
ctggcaggagatcctgccgaggtgcttggggaacagggtaccgcaccctgggccgaagag
gaggaggaagagagctccccaggcgaggacagcagcagccttggagggggacccagccgc
aggggacccctcccctgtcccttgtgcagccgcgagggtccctgctcctgtctgccattg
gagcggggggacgctgtggccggctggggggaccaccctgcccttggttgtccccacccc
ccagaggacgactcttccttgcgtgcagagcggggctccttggccgacctgcctctggtc
ccccctacctcagcccctctcgagtttctggacccccttatgggggccgcagcgccccag
taccccgggcgggggccacctcccgctcccccccctccaccgccccctccccgggcctcc
gcggaaccggccgcgtcccccgaccccccgtcggccctggccagtccaggctccggccta
tcgtctccgggccccaagccgggggacagcggctacgagaccgagacccctttttccccc
gagggagccttcccaggtgggggggcggccgaggaggaaggggtccctcggccacgggct
ccccccgagccacccgacccaggagcgccccggccacccccagacccgggtcccctccca
ctcccagggtcccaggagaagccaacctttgtagttcaggtgagcaccgagcagctgctg
atgtccctacgggaggatgtgacaaagaacctcctaggggacaaggggtcgacacccggg
gagacaggacccaggaaggcggggagaagccccgcgaacagagagaagggcccaggcccg
aacagggacctgacatccctggtcagcaggaagaaagtccccagcaggagccttccagtg
aacggggtgacagtgttggagaacgggaagccaggagtcccggacatgaaggagaaggtg
gcggagaatggcctggaatctccggagaaagaagagagagccctggtgaatggggagccg
atgtccccagaggccggggagaaggtgctggcgaatggggttctgatgtccccaaagagc
gaggagaaggtggcagagaatggggtcctgaggctgcccaggaacacggagaggccacca
gagattggacctcggagagtcccagggccctgggagaagacgcccgagactgggggtcta
gctcccgagaccctgctggatcgagcccctgcgccctgcgaggcagccttgccccagaac
ggcttggagatggcccctggccagcttggcccagcccccaagagcgggaacccagacccc
gggaccgagtggagagtccacgagagtgggggggcaccgagagcccccggggctgggaag
ctggacctcgggagtgggggccgagccctggggggcgtggggacggcccccgccggcggc
cccgcaagcgccgtggacgcaaaggccggatgggtagacaactcgagaccactgccacct
ccgccacagccactgggggcccaacagaggaggccggagccagtgcccctgaaagccagg
ccggaggtggcccaagaggaagagccaggggtcccagacaacaggctcggcggagacatg
gcccccagcgtagacgaggaccccctcaagccggagaggaagggccccgagatgccacgc
ttgttcctggacttgggaccacctcaggggaacagcgagcagatcaaagccaaactctcc
cggctctcgctggcgctcccaccgctcacgctcacgccgttcccgggcccgggcccgcgg
cggccaccttgggagggcgcggacgcaggggcagctggcggggaggccggcggggcgggg
gcgccggggccagcggaggaggacggggaggacgaggacgaggacgaggaggacgaggag
gcagcgggctctcgggatcccgggaggacgcgggaagccccagtgcccgtcgtggtgagc
agcgccgacggggacacggtccgcccgctgcgggggctgctcaagtctccacgcgcggcc
gacgagccagaggacagcgagctggagaggaagcgcaagatggtctccttccacggggac
gtgaccgtctacctcttcgaccaggagactccaaccaacgagttgagcgtccagggcacc
cccgagggggacacggagccatcaactcccccagcgcccccgacgcctccccaccccacc
accccaggagatgggtttcccaacagcgacagcggctttggcggcagtttcgagtgggcg
gaggatttccccctcctccccccgccaggcccccccctgtgcttctcccgcttctccgtc
tcacctgcactggagaccccggggcctcccgcccgggctcccgacgcccggcccgcaggc
cccgtggagaactga

DBGET integrated database retrieval system