KEGG   Mus musculus (mouse): 382000
Entry
382000            CDS       T01002                                 

Symbol
Defa39, AY76118, CRS1C, CRS1C-3, CRS1C-6
Name
(RefSeq) defensin, alpha, 39
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    382000 (Defa39)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    382000 (Defa39)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    382000 (Defa39)
SSDB
Motif
Pfam: Defensin_propep MF_alpha_N
Other DBs
NCBI-GeneID: 382000
NCBI-ProteinID: NP_001007583
MGI: 3611585
Ensembl: ENSMUSG00000058618
Vega: OTTMUSG00000019927
UniProt: Q9D848
Position
8; 8 A2
AA seq 116 aa
MKTLVLLSALALLAFQVQADPIKNTDEETKTGEQPEEEDQAVSVSFGGTEGSALQYVAQR
RFPWCRKCPVCQKCQVCQKCPVCPTCPQCPKLPLCKERQNKSAITTQAPNTQHKGC
NT seq 351 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgcccttgccctgctggccttccaggtccaggctgat
cctatcaaaaacacagatgaagagactaaaactggggagcagccagaggaagaggaccag
gctgtttctgtctcctttggaggcacagaaggctctgctcttcaatatgtagcccaaaga
aggtttccgtggtgccggaagtgcccagtgtgccagaagtgccaagtgtgccagaagtgc
cctgtgtgcccgacatgcccccagtgcccgaagctgccattgtgcaaagaaaggcaaaat
aaaagtgcaatcaccacccaagctccaaatacacagcataaaggctgttga

DBGET integrated database retrieval system