KEGG   Mus musculus (mouse): 382007Help
Entry
382007            CDS       T01002                                 

Gene name
Adam26b
Definition
(RefSeq) a disintegrin and metallopeptidase domain 26B
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Reprolysin ADAM_CR Disintegrin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Reprolysin_2 Reprolysin_4 Peptidase_M10 Peptidase_M57 DUF4953
Motif
Other DBs
NCBI-GeneID: 382007
NCBI-ProteinID: NP_001009547
MGI: 3588304
Ensembl: ENSMUSG00000063900
Vega: OTTMUSG00000061170
UniProt: Q6IMH6 Q9CUI8
Position
8; 8 A4
AA seq 699 aa AA seqDB search
MFLKFCLWTMFFFSAWSPIGHAKYSSLPEVVTPLRVTVTRGNNTSPGWLSYSLNIGGQRH
IITMKPKKNLMSRNLILLTYTQQGDLLEQRPFVPNDCYYHGYVDEDPESLVILNTCFGSL
QGTLEINGTTYEIMPKSSTSTFEHLAYKMDNGDSEPSPMRCGLSEEEIAQQRKLRERNAP
TLLQIPHENWWTHHRFIEYFVVIDHKQYVHRNNNITTCIQDMLQIVNGVNGYYLQIDTDV
VLTALEIWNEKNYINVELSIFKVLGDFCTWKQNMFGNRIRHDIIHLLVRQGYGLYLGLAY
LADVCTPYNCGVSSFLSDVMSDMAHIVAHEMGHNLGMKHDGIGCTCGLKDCLMAPYKTNS
PKFSNCSYEEMYSVVTKRSCLYDIPEALVTNLTVCGNKVVEEGEECDCGSTESCLQDPCC
SSDCVLKPGAQCAFGLCCQDCQFLKTGTVCREEKNECDLPEWCNGTSAECPGDVYKADGI
PCSGEGYCYKMECHQRDEQCRKIFGNGSRSADEICYMEMNRRGDRFGNCGNDSSKYKICE
LADVLCGRIQCENVIQLPQRRNHETVHYTHFSNVTCWTMDYHFGITIDDIGAVSDGTACA
PYHICVDRKCVSKSDLVSNCTTKLCHMQGVCNNKNHCHCTNTWEPPDCQLRGHGGSLDSG
PPPLHVPNSSWAFYFISFFTILLVITISLVGITKRVKMN
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgttccttaagttctgcctgtggacgatgttcttcttctctgcatggtcaccaattggg
catgctaagtacagtagccttccagaagtagtgacacctttaagggtcactgtcactaga
ggaaataatacttcaccaggttggctgtcctatagcctgaacattggggggcagagacac
ataatcactatgaaacccaagaaaaacttgatgtccagaaacttaatactattaacttat
actcagcaaggtgatctccttgaacaacgcccttttgtgccgaatgactgctattaccat
ggctatgtggatgaagacccagagtccctggtcattctcaacacctgttttgggagcttg
caaggcacactagagataaatggcacaacttatgaaatcatgcccaagagctcaacgtca
acatttgaacatctggcttacaaaatggacaatggggattcagaaccatctcccatgaga
tgtgggttatcagaagaggaaatagcacaacaaaggaagctacgagaacgcaatgccccc
acacttttacaaattccccatgagaattggtggacccaccacaggtttattgaatatttt
gtagtaatagaccataaacaatacgttcatagaaataacaatatcacaacttgtattcaa
gatatgttgcaaatagtcaatggagtaaatggttattatcttcaaatagatactgatgtg
gttttaactgctcttgaaatatggaatgaaaaaaactatatcaatgtagaactcagtata
tttaaagtccttggtgatttctgtacttggaagcaaaacatgtttggcaatcgcattaga
catgatatcatacaccttttagtcagacagggatatggtttatatttagggttagcttat
ttagctgacgtttgtacaccttataattgtggagttagcagtttcctttctgatgtaatg
tcagacatggcacacattgtagcacatgagatggggcataacttgggtatgaaacatgat
ggaattggatgtacttgtgggttaaaagactgtctaatggccccatataaaacaaattct
ccaaaattcagcaactgtagttatgaagaaatgtattcagttgttaccaaacgaagttgc
ttatatgatattccagaagcactagtaacaaacctgaccgtgtgtgggaataaggtggtt
gaagaaggagaggagtgtgattgtgggagcactgaatcctgtttacaagatccttgctgt
agcagcgactgtgttctcaaacctggtgctcaatgtgcttttggactttgttgccaagat
tgccagttccttaaaacaggcactgtgtgtagagaagagaaaaatgagtgtgaccttcca
gagtggtgcaatggaacttcagctgagtgtccaggagatgtgtataaagcagacggaatc
ccttgcagtggtgagggctattgctataaaatggaatgtcatcaacgtgatgagcagtgt
cggaagatttttggcaatggaagtagaagtgcagatgaaatttgctacatggaaatgaac
agacggggtgaccgctttgggaactgtggcaatgatagctctaagtataaaatatgcgag
ctcgcggatgtactctgtgggcgaattcagtgtgagaatgtgatacaacttccccaaagg
agaaaccatgaaacagtgcattatactcacttcagtaatgtcacctgctggactatggac
tatcattttgggatcaccatagatgatattggagctgtgagcgatggcacagcttgtgct
ccataccatatatgtgttgacagaaagtgtgtcagcaagtctgatctggtaagtaactgt
acaaccaagttatgccatatgcaaggagtctgcaacaataaaaaccactgccattgtact
aacacatgggaaccaccagactgtcaactacgtggccatggaggtagtttagacagtggg
ccacctccattgcatgtcccaaattctagttgggctttttacttcattagtttttttact
attttattggttatcacaatttctttagttggcataaccaagagggtaaaaatgaattaa

DBGET integrated database retrieval system