KEGG   Mus musculus (mouse): 382034
Entry
382034            CDS       T01002                                 

Gene name
Gse1, 2210013I18Rik, mKIAA0182
Definition
(RefSeq) genetic suppressor element 1, coiled-coil protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: DUF3736
Other DBs
NCBI-GeneID: 382034
NCBI-ProteinID: NP_001139368
MGI: 1098275
Ensembl: ENSMUSG00000031822
Vega: OTTMUSG00000031594
UniProt: Q3U3C9
Position
8; 8 E1
AA seq 1213 aa
MKGMSHEPKSPSIGMLSTATRTTATVNPLTPSPLNGALVPTGSPATSSTLSAQAAPSSSF
AAALRKLAKQAEEPRGSSLSSESSPVSSPATNHSSPASTPKRVPMGPIIVPPGGHSVPST
PPVVTIAPTKTVNGVWRSESRQDSGSRGSSSGRERLLVEPPLAQEKAAGPAIPSHLLSTP
YPFGLSPGSVVQDSRFQPLNLQRPVHHVVPPSTVTEDYLRSFRPYHTAEDLRMSSLPPLG
LDPATAAAYYHPSYLAPHPFPHPAFRMDDSYCLSALRSPFYPIPTPGSLPPLHPSAMHLH
LSGVRYPPELSHSSLAALHSERMSSLSAERLQMDEELRREREREREREREADREREKERE
REQREKEREKELEREREKERERELERQREQRAREKELLAAKALEPTTFLPVAELHGLRGH
STEERPKPSEQLTPTRAEKLKDVGLQAPKPVQHPLHPVPAPHHTVPSLISSHGIFSLPGS
SATTALLIQRTNEEEKWLARQRRLRQEKEDRQSQVSEFRQQVLEQHLDLGRPLVPTEAEH
RPESTRPGTNRHEQGSREPPQHFGGPPPLISPKPQQHTVPTALWNPVSLMDNALETRRAE
SHSLHSHPTAFEPSRQAAVPLVKVERVYCSEKAEEPRKREATPLDKYQPPPPPPPPREAG
SLEPQTFPHGPGPFLTELEKSTQTILGQQRPSLSQATSFGELSGPLKPGSPYCHPTARGP
DPAYIYDEFLQQRRKLVSKLDLEERRRREAQEKGYYYDLDDSYDESDEEEVRAHLRCVAE
QPPLKLDTSSEKLEFLQLFGLTTQQQKEELVAQKRRKRRRMLRERSPSPPAVQCKRQTPS
PRLALSTRYSPDEMNNSPNFEEKRKFLTFFNLTHISAEKRKDKERLVEMLRAMKQRALSA
ADSVTNSSRDSPPVSLSEPATQPAPLETDQPVGVPASLSDVPKTTETGRLEQLRPQELLR
VQEPAPPSGEKARLSEAPGGKKSLSMLHYLRGAAPKDIPVPLSHSINGKSKPWEPFVAEE
FAHQFHESVLQSTQKALQKHKGNSALLSAEQSHKVDTAIHYNIPELQSSSRVPLPQHNGQ
QEPPMGRKGPPMQEADQDSEEDSEEDSEEEAEEAPRRQWQGIEAIFEAYQEHIEEQNLER
QVLQTQCRRLEAQNYSLSLTAEQLSHSMAELRSQKQKMVSERERLQAELDHLRKCLALPT
MHWPRGYFKGYPR
NT seq 3642 nt   +upstreamnt  +downstreamnt
atgaaaggcatgagccatgagcccaagtccccttccatagggatgctttccacggcgacc
aggaccaccgccaccgtcaaccccctcaccccctcgccactcaatggcgccctggtgccc
accggtagcccggccaccagcagtacgctgtcggcccaggccgctccatcctccagcttt
gctgccgcactgcgcaagctcgccaaacaggcagaggagcccagagggtcctcactgagc
agcgagtcatctccagtgtcctctccagccaccaaccatagctctccagctagcacgccc
aaacgagtgcccatgggccccatcatcgtcccccccgggggtcacagtgtccccagcact
cccccagtggtcactattgcccccactaaaaccgtcaatggagtctggagaagcgagagc
cgccaggactctggctcacgaggcagcagcagtggtcgggagcgcctattggtggagcca
cctctcgcccaggaaaaggctgcgggccccgccatcccctcccacctactcagcaccccg
tacccctttggcctttcccccggctcagttgtacaggactcccgcttccaaccactcaac
ctccagcggcctgtgcaccatgtggtgccccccagcacggtgactgaggactacttgaga
agcttccggccctaccacactgctgaagacttacgcatgtcctccttgcctccgcttggc
ctggacccagccaccgccgcagcctactatcaccccagctacctggccccacacccattc
ccccacccggccttcaggatggatgactcctattgcctgtcagccttaaggtctccgttc
taccccatccccacccctggctccctgcctccactgcatccgtcggcgatgcacctgcat
ctctccggcgtacggtatcctcctgagctctcccactcgtccctggcggcgctacactcg
gagcggatgtccagcctcagtgcagagaggttgcaaatggacgaggaactgcggcgggag
agagagcgagagcgggaacgggaacgggaggccgaccgggagcgggagaaggagcgggag
cgggagcagcgggagaaggagcgggagaaggagctggagcgcgagcgggagaaggaacgg
gagcgcgagctggagcggcagcgggagcagcgggcgagggagaaggagctgctggctgcc
aaggccttagagcccaccaccttcctgcctgtggccgagctgcacggactccgaggtcac
agcacggaggagcggcccaagccctcggagcagctgaccccaacccgagcagagaagctg
aaggacgtgggcttgcaggcgcccaagcccgtgcagcaccctctgcacccagtgcctgcc
ccacaccacacggtgcccagcctcatctccagccacggcatcttctctctgcctggaagc
agcgccaccaccgccctgctgatccagcgcaccaacgaggaggagaagtggctggcacgg
cagcgccgcctgcggcaggagaaggaagaccgccagtcccaggtgtccgagttccggcag
caggtcctggagcagcacctagacctgggccggcccctggtgcccacagaggcggagcac
aggcccgagagcaccaggccaggaacaaaccggcatgagcagggcagccgtgaaccccca
cagcactttggtggccctccacccctcatctcacccaagccccagcagcacaccgtaccc
acagccctctggaacccagtgtctctgatggacaatgctctggagacgcggcgggccgag
agccactctctgcatagccacccgactgcttttgagcccagccgccaggccgccgtgcca
ctggtgaaggtggagcgagtttattgctcagagaaggcagaggagccccggaagcgtgag
gccacaccactggacaaataccagccaccaccaccaccaccaccaccgcgggaggcagga
agtctggagcctcagacctttccccacggacctgggcctttccttactgaacttgaaaag
tcaacacagaccatcttgggccagcagcggccctctctttcccaggcaacctccttcggg
gagctcagtgggcctctgaaaccaggctctccgtactgccaccccacagcgaggggcccc
gatccagcctacatctacgatgagtttcttcagcagcgacggaagctggtcagcaaactg
gacctggaggaacgcaggcggcgcgaggcccaggagaaagggtactactacgacctcgat
gactcgtacgacgagagtgacgaggaggaggtcagggcacacctccgctgtgtggctgag
cagccgcccctcaaactggacacatcctcggagaagctagagttcttgcaactttttggc
ttgaccacccaacagcagaaggaggaactggtggcgcagaagcgccggaagcggaggcgg
atgctcagagagagaagcccgtcgccacctgccgttcagtgcaagcgacagacgccttcc
cccaggctggctctgtccacccgctacagccccgacgagatgaacaacagccccaacttt
gaggagaagaggaagttcctgaccttcttcaacttgacgcacatcagtgcggagaagagg
aaagacaaagagaggcttgttgaaatgctccgagccatgaagcagagagcactgtccgca
gcagactcagtgacaaactcttcgagggacagtcctcccgtctccctgagtgaaccagcc
acacagccagctcctctagagacggatcagcctgtcggggtccctgcctccttgtcagat
gtcccaaagaccacggagaccgggagactggaacagctccggccccaggagctcttgaga
gtccaggagccggctcctcccagtggtgagaaggccaggctgagcgaggcccctggtggc
aagaagagcctgagcatgctccattacctccggggcgccgcgcccaaggacattcctgtg
ccgttgtctcacagcatcaacgggaagagcaagccctgggagcctttcgtggccgaagag
tttgcacatcaattccacgagtccgtgctgcagtccacacagaaggctctgcagaagcat
aaagggaactctgctttgctatctgcagagcagagccacaaagtcgacacggcaatccac
tacaacattcccgagctgcagtcctccagcagggtccccttgccccagcacaatggacaa
caggagcctccaatggggaggaagggccctcctatgcaggaggcggaccaggactctgag
gaggactctgaggaggacagcgaggaggaagctgaggaagccccgaggcgccagtggcaa
gggattgaggcaatctttgaagcttaccaggaacacatagaagagcaaaacctggagcgg
caggtgctgcagacgcagtgccggcggttggaggcgcagaactacagcctcagcctgact
gcggagcagctgtctcacagcatggcggagcttcggagtcagaaacagaagatggtctct
gagcgggagcggctccaggcggagctggaccacttgcggaagtgccttgccttgcccacc
atgcactggcctaggggctactttaagggatatccgaggtga

DBGET integrated database retrieval system