KEGG   Mus musculus (mouse): 382059
Entry
382059            CDS       T01002                                 

Symbol
Defa22, Defcr2, Defcr22
Name
(RefSeq) defensin, alpha, 22
  KO
K05230  defensin, alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
mmu05150  Staphylococcus aureus infection
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    382059 (Defa22)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    382059 (Defa22)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    382059 (Defa22)
SSDB
Motif
Pfam: Defensin_propep Defensin_beta Defensin_1 MF_alpha_N
Other DBs
NCBI-GeneID: 382059
NCBI-ProteinID: NP_997541
MGI: 3639039
Ensembl: ENSMUSG00000074443
Vega: OTTMUSG00000019763
UniProt: Q8C1N8 W4VSN6
Position
8; 8 A2
AA seq 93 aa
MKTLVLLSALILLAYQVQTDPIQNTDEETNTEEQPGEEDQAVSVSFGGQEGSALHEKLSR
DLICLCRKRRCNRGELFYGTCAGPFLRCCRRRR
NT seq 282 nt   +upstreamnt  +downstreamnt
atgaagacacttgtcctcctctctgccctcatcctgctggcctaccaggtccagactgat
cctatccaaaacacagatgaagagactaatactgaggagcagccaggggaagaggaccag
gctgtgtctgtctcctttggaggccaagaaggatctgctcttcatgaaaaattgtcgaga
gatctgatctgcctttgtagaaaacgtcgctgcaatagaggagaactattttatgggacc
tgcgcaggaccttttttgcgctgctgccgccgccgccgctga

DBGET integrated database retrieval system