KEGG   Mus musculus (mouse): 382089Help
Entry
382089            CDS       T01002                                 

Gene name
Ripply2, C030002E08Rik, Gm1122
Definition
(RefSeq) ripply transcriptional repressor 2
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Ripply
Motif
Other DBs
NCBI-GeneID: 382089
NCBI-ProteinID: NP_001032996
MGI: 2685968
Ensembl: ENSMUSG00000047897
Vega: OTTMUSG00000045052
UniProt: Q2WG76
Position
9; 9 E3.1
AA seq 128 aa AA seqDB search
MDTTESAESAHNPARPPSRSRCPPSAQPGSEGFWRPWVRTPGEKEKRTGPRAAEALPSGP
GMAEASGKLLQYQHPVRLFWPKSKCYDYLYQEAETLLKNFPIQATISFYEDSDSEDEIEG
LACENQSN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggataccaccgagagcgccgagagcgcgcacaacccagcacgtccgccctcgcgcagc
cgctgcccgccgtccgcgcagcccgggtccgagggcttctggagaccgtgggttcgaact
cctggagagaaagagaagcggacggggccccgtgctgcagaggcgttgcccagtggccca
ggaatggcagaagcttccgggaagcttttgcaataccaacaccctgtcaggctattctgg
cccaagtccaagtgttacgactacttatatcaagaagcagaaactcttctgaaaaatttc
ccaattcaagctacaatttcgttttatgaagattctgatagtgaagatgaaatagagggg
ctggcctgtgaaaatcaatctaattag

DBGET integrated database retrieval system