KEGG   Mus musculus (house mouse): 382207
Entry
382207            CDS       T01002                                 
Symbol
Jade3, 5730598B06, Phf16, mKIAA0215
Name
(RefSeq) jade family PHD finger 3
  KO
K22156  protein Jade-3
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    382207 (Jade3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    HBO1 complex
     382207 (Jade3)
SSDB
Motif
Pfam: zf-HC5HC2H_2 zf-HC5HC2H PHD_2 PHD EPL1 C1_1 Prok-RING_1 Phage_RpbA C1_2
Other DBs
NCBI-GeneID: 382207
NCBI-ProteinID: NP_955021
MGI: 2148019
Ensembl: ENSMUSG00000037315
UniProt: Q6IE82 A0A140T8R5
Position
X:20291277..20386178
AA seq 823 aa
MKRHRPVSSSESSDECPSTSFTSSSMYRKKSKNPKEQKKSAEVFRKDLISAMKIPDSHHV
NPDSYYLFTDTWKEEWEKGVQVPANPDSVPTPSLRIISEKVKEMLFVRPRKYIRCSSPES
AEPGYINTLEQAASTCRYDLDDMDIFWLQELNEDLGEMGYGPIDETLMEKTIEVLERHCH
ENMNHAIETVEGLGIEYDEDVICDVCRSPDSEEGNDMVFCDKCNVCVHQACYGILKIPEG
SWLCRSCVLGIYPQCVLCPKKGGAMKTTRTGTKWAHVSCALWIPEVSIACPERMEPVTKI
SHIPPSRWALVCNLCKLKTGACIQCSVKSCITAFHVTCAFEHGLEMKTILDEGDEVKFKS
FCLKHSQNKPKLGDAEYHHHRVAEQSQAKSEKTSLRAQKLRELEEEFYTLVQVEDVAKEM
ELSAFTVDFIYNYWKLKRKSNFNKPLIPPKEEEENGLVQPKEESIHTRMRMFMHLRQDLE
RVRNLCYMISRREKLKLSHTKVQEQIFGLQVQLINEEITEGLSLTNALENSLFYPPPRIT
LKLKMPKSTSEDCKDSSTETEHQLSSPGSSSPGHSKRSPQMPEEPLDMNVKIYPRYPLES
KSNCLQTSRSHSRCETKSSSPTPRAPSAEFYHGQSLGKPLALQAALHGQVSIGNGKNQPN
SRVSSSNGLEGNWSGNITQKVNSSEVCYDQESMLSSHLPSPGNIRKSSMEHFSRSFKEAT
NTWVKPTEDLQYCVKPTKNVSSKEQLWGRQLLRRPTGRASYQETDGYCPDLEPSDSEAEG
EGSKETPRVKRESSDRENPSHDSARECHGKTKTHPHSHSSMQR
NT seq 2472 nt   +upstreamnt  +downstreamnt
atgaaacggcatagacctgtcagcagcagtgagagttcagatgagtgtccttccacttcc
tttacttctagctcaatgtataggaagaagtcaaaaaatcctaaggaacagaagaagtct
gctgaggtattccgaaaggacctcatcagtgccatgaaaattcctgactctcaccatgtt
aatcctgacagctattacctctttactgacacatggaaagaagaatgggaaaaaggagtc
caagtaccagccaatccagactctgttccaacgccgtctctcaggattatatctgaaaaa
gtaaaggagatgctttttgtccggccccggaaatatatccgttgctccagcccagagtct
gcagaacctggctatatcaataccctggagcaagcagcatctacatgccgctatgaccta
gatgacatggatatcttttggcttcaggaactcaatgaagaccttggagaaatgggttat
ggcccaattgatgagactcttatggaaaagacaatagaagttctggaacgccactgccat
gaaaatatgaaccatgctattgaaacagtggaagggctaggaatagaatatgatgaagat
gtgatctgtgatgtgtgccggtctccagacagtgaagaagggaatgatatggtattctgt
gataagtgtaacgtctgtgtacatcaggcttgctatggcattctcaagattccagaaggt
agttggctgtgccgctcctgtgtcctgggcatttatccacagtgtgttttatgtcctaag
aaaggtggagccatgaagaccaccagaacagggactaaatgggctcatgtcagctgtgcc
ctgtggattccagaagtcagtatcgcttgtcctgagagaatggagcctgtcacaaaaatc
tcccatatcccacctagccggtgggccttagtttgcaacctgtgcaagttgaagacaggg
gcttgtattcagtgctctgtgaaaagctgtatcactgcctttcatgtcacctgtgccttt
gagcacggcctggaaatgaagaccatcctagatgagggggatgaagtaaagttcaagtca
ttttgcctcaagcatagccaaaacaagccaaaacttggggacgccgagtaccaccaccac
agagtcgccgagcagagccaggcaaaaagtgagaaaaccagcctacgggcacagaagctt
cgtgaactagaagaagaattctataccttagtccaggtagaagatgttgccaaagagatg
gagttatctgcgttcactgtcgattttatctataactactggaaactaaagcgcaaaagc
aacttcaataagccattaattcccccaaaagaagaggaagaaaatggcttggttcagcca
aaagaagaaagcattcacactcggatgagaatgtttatgcatctgcggcaggaccttgag
agggtccgaaatctgtgctacatgataagcagacgagagaagctgaaactatcacacacc
aaagtgcaggaacagatttttggtttgcaagtccagcttatcaatgaagaaattacagaa
ggactttctttgacaaatgcactagagaactcactgttttatccaccaccacgaattacc
ttaaagttaaaaatgcctaaatcaacctcagaagattgcaaagacagctccacagaaact
gaacaccaactctcgtctcctggcagcagctcccctggtcacagtaaaaggagccctcag
atgcctgaggaaccactggatatgaatgtgaaaatatatccaagatatccactagaaagc
aaaagtaactgtttgcagactagccgaagccattctcgatgtgaaaccaagagctccagt
cctactccgagagctccatctgcagaattctatcatgggcaatcactagggaagcctctg
gcccttcaggctgccctccatggacaggtgtctattggtaatgggaagaatcagcctaac
tccagggtttctagttccaatggcctggagggcaactggtctgggaacatcacccagaaa
gttaattcaagtgaggtgtgctatgaccaggagtccatgctcagctcccacttacccagt
ccaggcaacattagaaaatctagcatggaacatttcagcaggtccttcaaggaggccacc
aatacatgggtgaagcctactgaggacctccagtactgtgttaagccaactaagaatgtg
agctctaaggagcagttgtggggtagacagcttctcaggcgtcccacaggaagagcttca
tatcaggaaactgatggctattgccctgatttggagcccagtgattcagaagcagaaggg
gaggggagtaaagaaacaccaagggtaaagagagagagttctgacagagaaaatccttcc
catgattctgctcgggagtgccatgggaaaaccaagacacaccctcattcccacagctca
atgcaaaggtga

DBGET integrated database retrieval system