KEGG   Mus musculus (mouse): 382236Help
Entry
382236            CDS       T01002                                 

Gene name
Brwd3, Brodl, D030064D06Rik, Gm10452, Gm596
Definition
(RefSeq) bromodomain and WD repeat domain containing 3
  KO
K11798  bromodomain and WD repeat domain containing protein 1/3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    382236 (Brwd3)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     382236 (Brwd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 Bromodomain ANAPC4_WD40 Auxin_resp
Motif
Other DBs
NCBI-GeneID: 382236
NCBI-ProteinID: NP_001074946
MGI: 3029414
Ensembl: ENSMUSG00000063663
Vega: OTTMUSG00000018333
UniProt: A2AHJ4
Position
X; X D
AA seq 1799 aa AA seqDB search
MAAAPTQIEAELYYLIARFLQSGPCNKSAQVLVQELEEHQLIPRRLDWEGKEHRRSFEDL
VAANAHIPPDYLLKICERIGPLLDKEIPQSVPGVQTLLGVGRQSLLRDAKDCKSTLWNGS
AFAALHRGRPPELPVNYVKPPNVVNITSARQLTGCSRFSHVFPSSAYQHIKMHKRILGHL
SSVYCVAFDRSGRRIFTGSDDCLVKIWATDDGRLLATLRGHSAEISDMAVNYENTLIAAG
SCDKVVRVWCLRTCAPVAVLQGHSASITSIQFCPSTKGTTRYLTSTGADGTICFWQWHVK
TMKFRDRPVKFTERSRPGVQISCSSFSSGGMFITTGSTDHVIRIYYLGSEIPEKIAELES
HTDKVVAVQFCNNGDSLRFVSGSRDGTARIWQYQQQEWKSIVLDMATKMSGNNLTSAEDK
VTKLKVTMVAWDRYDTTVITAVNNFLLKVWNSVTGQLLHTLSGHDDEVFVLEAHPFDQRI
ILSAGHDGNIFIWDLDRGTKIRNYFNMIEGQGHGAVFDCKFSPDGNHFACTDSHGHLLLF
GFGCSKYYEKIPDQMFFHTDYRPLIRDANNYVLDEQTQQAPHLMPPPFLVDVDGNPHPTK
FQRLVPGRENCKDEQLIPQLGYVANGDGEVVEQVIGQQTNDQEESILDGIIRELQREQDL
RLINEGDVPHFPINRSYSVNGALSSPNMDIPSSPNIGLRRSGQIEGVRQMHNNAPRSQMA
TERDLMAWSRRVVVNELNSGVSRVQEECRNAKGDLEVSLYTVEKKKKPSYPIQRNDYQPS
CGRSLRRTQRKRQHTYLTRSNIEHNSQASSQTSGVQEDSDSSSEEDETVGTSDASVEDPV
VEWQSESSSSDSSSEYSDWIADAGINLQPPKRQTRQATQKIYSSSEDENLKLEDRQKKPK
QTKKKKGGLVSMAGEPNEEWLAPQWILDTIPRRSPFVPQMGDELIYFRQGHEAYVRAVRK
SKIYSVNLQKQPWNKMDLREQEFVKIVGIKYEIGPPTLCCLKLAFLDPISGKMTGESFSI
KYHDMPDVIDFLVLHQFYNEAKERNWQIGDRFRSIIDDAWWFGTVESQQPFQPEYPDSSF
QCYSVHWDNNEREKMSPWDMEPIPDGTAFPDEVGAGIPVSQEELTALLYKPQEGEWGAHS
RDEECERVIQGINNLLSLDFASPFAVPVDLSAYPLYCTVVAYPTDLNTIKQRLENRFYRR
ISALMWEVRYIEHNARTFNEPDSPIVKAAKIVTDVLLRFIGDQSCSDILDTYNKIKAEDP
DSSDLEEDSEMVDLDSDGPGTSSGRRAKCRGRRQSLKCNPDAWKKQCEELLSLIYEREDS
EPFRQPADPQSYPVQQQQEGESSQSVPPDRQDPSLSEDYQDGIDTPMDFSTVKETLESGN
YDSPLEFYKDVRQIFSNSKAYTSNKKSRIYSMTLRLSALFENHIKNIISDYKSAIQSQKR
RRPRYRKRLRSSSSSLSSSRAPSPKGKQKQMKLQPKNDQNTSVAYARTSSPFSSPVSDAA
EGVSLYLLDDEGDGPFSPSSFSGYSRSGNSHDPGKAKSFRNRVLPAKQDHSLDGPLTNVD
GREPRTGAKRKLLSASEEDESMGGEEKEMKETKEQVHLSSSESGELGSSLSSESTSGSDS
DSESTSRTDQDYVDGDHDYSKFIQTRPKRKLRKQHTNGKRNWKTRGTGGRGRWGRWGRWS
RGGRGRGGRGRGGRGRGGGGGRGRGRGRGGRGASRGSSRAKRARVADDEFDTMFSGRFSR
LPRIKTRNQGRRTVLYNDDSDNDNFVSTEDPLNLGTSRSGRVRKMTEKARVSHLMGWNY
NT seq 5400 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcacctacccagatcgaagccgagctgtattacctgatcgcaaggttcttg
cagtccggaccctgtaacaaatccgctcaggtgctagtgcaagagctcgaagagcatcag
ctgattccgcgccgcttagactgggaagggaaagagcaccgaagaagcttcgaggatctg
gtggcagccaatgcacacattcctccagactacctccttaaaatttgtgagaggattggc
cctttattagataaggaaatccctcagagtgttcctggggtacagacattactaggtgtc
ggtcggcagtctctgttacgggatgccaaagactgtaagagtacactatggaatgggtct
gcttttgcagccctccacagaggcagacccccagaactacctgtaaattatgtgaaacct
ccaaacgtggtgaatatcacctcagccaggcaattaaccggatgtagtcgcttcagccat
gttttcccctcatctgcttaccagcacattaagatgcataagagaattctgggacactta
tcttctgtctactgtgtagcctttgatcgaagcgggaggcgaatttttacaggttcagat
gactgtttggtgaaaatctgggcaacagatgatggacgcctccttgccacactgcgaggg
cactctgctgaaatctccgacatggctgttaattatgaaaatactctcattgctgcaggc
agctgtgataaagttgtgagagtatggtgtcttcgtacttgtgcaccagttgctgtcctt
cagggacattcagcttctattacttccatacagttttgtccatcaactaaaggcacaact
agatacctcacttctactggtgctgatggaacaatttgtttctggcaatggcatgtaaaa
acaatgaagtttagagatcgcccagtaaaatttactgagagatccagacctggagttcag
atatcttgttcatctttcagttctggtggtatgttcattacaacagggagcactgatcat
gtaattaggatatactatttgggttctgagatacctgagaaaattgctgaattagaatca
catacggacaaagttgttgctgttcagttctgtaacaacggagacagcttaaggtttgtt
agtggaagtagagacggaacagcaagaatatggcaatatcaacaacaagagtggaagagc
atagtgctagatatggctactaaaatgagtgggaataatttgacatcagctgaagacaaa
gtcactaaactaaaggtgactatggtggcttgggatcggtatgataccactgttattact
gcagtgaacaatttccttttgaaagtttggaattctgtcacagggcagcttcttcatact
ttatctgggcatgatgatgaagtatttgttctagaagcacatccatttgatcaaaggatc
atactttcagcaggtcatgatgggaacatttttatttgggaccttgaccgggggaccaaa
atacgaaattactttaatatgatcgaaggccaaggtcatggtgcagtatttgattgtaaa
ttttcaccagatggaaaccattttgcctgtacagactctcatgggcatttgttgctattt
ggctttggatgcagtaaatactatgaaaagattccagatcagatgttcttccataccgat
tatcggcccctcatcagagatgccaataactatgtattagatgaacaaactcaacaagct
cctcacctcatgcctcccccattcttggtggatgtcgatggaaatcctcatcctacaaaa
tttcaacggctggtaccaggacgggaaaactgtaaagatgaacaacttattccacagtta
ggatatgtggctaatggtgacggtgaggtggtagaacaggtaattgggcagcaaaccaat
gaccaagaagaaagcattcttgatggaataatcagggagttacagagagaacaagatctc
agattaattaatgaaggagatgttccacattttccaattaatagatcatattctgttaat
ggtgctctgagtagtccaaatatggacataccttcttccccaaatattggccttcggcgt
agtggccaaattgaaggtgttcggcagatgcacaacaatgctccccggagccagatggcc
actgaaagagatctcatggcctggagccgaagagtggtggtgaatgagctaaatagtggc
gttagtagggtacaagaagaatgtcgaaatgcaaaaggtgacctagaagttagtctttat
actgttgaaaagaagaaaaagccatcttatcctatccaaagaaatgattatcagcccagc
tgtggaaggtctttacgaaggacacaacgcaagcgacagcatacttacctaacaaggtcg
aacatagagcataattcacaggcatcatctcaaacttccggtgtacaagaagattcagac
agctcttcagaggaagatgaaactgttggcacaagtgatgcttccgtagaagaccctgtt
gttgagtggcaaagtgagagttcttccagcgattcatcaagtgaatattctgactggata
gcagatgctgggataaatttgcagcctcccaaaagacaaacaagacaggcaacacagaaa
atatacagcagttctgaagatgaaaatttgaaattagaagataggcagaagaaacctaaa
cagactaaaaagaagaaagggggacttgtttctatggcaggcgaacccaatgaagaatgg
cttgcccctcagtggatcttggataccataccacgacgttctccttttgttccacagatg
ggagatgagcttatttactttcgacaaggacatgaagcttatgtgcgagctgtaaggaaa
tcaaaaatctatagtgttaatttacaaaaacagccatggaacaaaatggatctcagggag
caagaatttgtgaagattgtaggaatcaaatatgagattggaccacctacgctatgctgc
ttgaaacttgcatttttggatccaatttcaggcaaaatgactggagagtctttttccatt
aagtatcatgacatgccagatgtcattgatttccttgtgttacatcagttttataatgaa
gccaaagaaagaaactggcagattggtgatagattccgcagtataatagatgatgcctgg
tggtttgggactgtggaaagtcagcagccttttcagccagaatatcctgatagctccttc
cagtgttacagtgttcactgggacaataatgaaagagaaaaaatgagcccctgggatatg
gagccgattccagatggaactgcttttccagatgaagttggtgctggtattcctgtgtcc
caggaagaactaactgcattgctctacaaaccccaggaaggagagtggggtgctcattcc
agagatgaggagtgtgaacgagttattcagggcatcaacaaccttctttccctggatttt
gccagcccttttgctgttccagtggatctcagtgcctaccccttgtattgtactgtagtt
gcttatccaactgacctcaataccatcaaacaaagacttgaaaatcgcttttacaggaga
atatcagcattaatgtgggaggtacgctatattgaacacaatgctaggactttcaatgag
ccagatagtcccatagttaaagcagccaagattgtgactgatgtcctacttcggtttatt
ggggatcaaagctgttctgatattttggatacttacaataaaatcaaagcagaagatcca
gacagcagcgatctggaggaggattcagaaatggttgacttagattcagatggtcctggc
acttcatctggaaggagggctaaatgtcgaggcagacgacagtctctcaagtgtaatcct
gatgcttggaaaaagcaatgcgaagagctactgagcctcatttatgaacgggaagactca
gagccatttcgtcagccagcagatcctcaatcttacccagttcaacagcaacaagaaggg
gaatcctcacaatcagttcctccagataggcaagacccatctctttctgaggattatcaa
gatggtatagacacacctatggacttcagcactgtgaaagaaactttggaatcaggaaat
tatgatagtcctctggaattttataaagatgttcgccaaatattcagcaactccaaagct
tatacttctaataaaaagtcaaggatctatagcatgacgctgagattgtcagccttattt
gaaaatcacattaaaaacatcatctctgactataagtcagcaatccagagtcagaagagg
agaagaccacggtacagaaagcgtctgagaagcagcagcagctcgttatctagcagcaga
gctcccagtccaaaaggcaaacagaagcaaatgaagttacagcctaaaaatgaccagaat
acctcagtggcttatgccaggactagctctcctttttcttctcctgtttcagatgctgct
gaaggtgtttcactgtatctacttgatgatgaaggggatgggcctttttctccatcaagt
ttcagtggatatagtagaagtggaaatagccatgacccagggaaagccaaatcatttcgt
aatagagttttaccagctaaacaagatcactcccttgatggacctcttacaaatgttgat
ggcagagagccccggacaggagccaaaagaaaactgctcagtgcttcagaagaagatgaa
agcatgggaggagaagagaaagaaatgaaagaaacaaaggagcaagtacatttatcctcc
tctgagagtggagagttaggctccagtttaagttcagaaagtacctctggctctgactct
gactctgaatccacttccagaaccgatcaagattatgttgatggagaccatgactatagc
aaattcatacaaaccagacctaaaaggaaactcagaaaacaacacaccaatggaaaaaga
aactggaagacgagaggcacaggaggaagaggcagatggggaagatggggaagatggagc
agaggaggcagaggaagaggtggcaggggtcgagggggtcgagggcgaggtggaggtggg
gggagagggagaggacgagggagaggaggaagaggtgcctctagaggatcaagccgagcc
aaacgagcccgagttgcagatgatgaatttgatacgatgttttcaggacgtttcagtcga
cttccacggattaaaacaagaaaccaaggcaggagaactgttttatataatgatgattca
gataatgacaactttgtgtccactgaggatcctctgaatcttggtacatccagatcaggc
agagtacgtaaaatgaccgaaaaagccagggttagccatctcatgggatggaattattaa

DBGET integrated database retrieval system