KEGG   Mus musculus (mouse): 382253
Entry
382253            CDS       T01002                                 

Gene name
Cdkl5, BC038161, Stk9
Definition
(RefSeq) cyclin-dependent kinase-like 5
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    382253 (Cdkl5)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     382253 (Cdkl5)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   382253 (Cdkl5)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr RIO1 Pkinase_fungal
Other DBs
NCBI-GeneID: 382253
NCBI-ProteinID: NP_001019795
MGI: 1278336
Ensembl: ENSMUSG00000031292
Vega: OTTMUSG00000019591
UniProt: Q3UTQ8
Position
X F4; X 73.95 cM
AA seq 938 aa
MKIPNIGNVMNKFEILGVVGEGAYGVVLKCRHKETHEIVAIKKFKDSEENEEVKETTLRE
LKMLRTLKQENIVELKEAFRRRGKLYLVFEYVEKNMLELLEEMPNGVPPEKVKSYIYQLI
KAIHWCHKNDIVHRDIKPENLLISHNDVLKLCDFGFARNLSEGNNANYTEYVATRWYRSP
ELLLGAPYGKSVDMWSVGCILGELSDGQPLFPGESEIDQLFTIQKVLGPLPSEQMKLFYS
NPRFHGLRFPAVNHPQSLERRYLGILNSVLLDLMKNLLKLDPADRYLTEQCLNHPTFQTQ
RLLDRSPSRSTKRKPYHVESSTLSNRNQSTKGAALQTHHRSNSKDIQNLSVGLPRAEEGL
PANESFLNGNLAGATLSPMHTKTYQASTQPGSSSKDLTNNNIPHLLSPKEAKSKTEFDFN
IDTKPSEGPGTKYLKSSTRSQQNRHSFMESSQSKAGTLQPSEKQSRHSYIDTIPQSSRSP
SYRTKAKSHGALSDSKSVSNLSEARAQITETNTSRYFPSSCLDLNSPTSPTPTRHTDTRT
LLSPSGRNNRNEGTLDSRRTTTRHSKTMEELKLPEHMDSSHSHSLSAPHESFSYGLGYTS
PFSSQQRPHRHSMYVTRDKVRAKGLDGSLSIGQGMAARANSLQLLSPQPGEQLPPEMTVA
RPSVKESSREGASSFHTRQKSEGGVYHDPHSDDGTAPKENRHLYNDPVPRRVGSFYRVPS
PRPDNSFHENNVSTRVSSLPSDSSSGTNHSKRQPGFDPWKSPENISHADQLKEKEKQGFF
RSMKKKKKKTQTVPNTDGPDLLTLQKAIHSSSTASSRPKEWRPEKLSDLQTQSQPLKSLR
KLLHLSSSTNHPASSDPRFQPLTAQQAKNSFSEIRIHPLSQATGGSSNIRQEPTPKGRPA
LQLPGSSLLRYNGWKHSRSRSSQPDEVIFLASHEKWKQ
NT seq 2817 nt   +upstreamnt  +downstreamnt
atgaagattcctaacattggtaatgtgatgaataaatttgagatccttggggttgtcggt
gaaggagcctatggagttgtacttaaatgcagacacaaggaaacacatgaaattgtggca
atcaagaaattcaaggacagcgaagaaaatgaagaagtcaaggagacgaccttacgagag
cttaaaatgcttcgcactctcaagcaggaaaacattgtggagctgaaggaagcttttcgt
cggagaggaaaattatacctggtgtttgaatatgttgagaagaatatgcttgaattgctg
gaagaaatgccaaatggagttccacctgaaaaagtcaagagctatatctaccaactaatc
aaagctatccactggtgccacaagaacgacatcgtccacagagatataaagcctgaaaat
ctcttaatcagccacaatgatgtcctgaaactatgtgactttggttttgctcgcaatctc
tcagagggcaataatgctaattatacagagtatgtggctacaaggtggtaccgatcccca
gaactgctacttggagccccctatggaaagtcagtggacatgtggtcagtgggctgtatt
cttggagagcttagtgatggccagcccttatttcctggagaaagtgaaattgaccaactc
tttactattcagaaggtgctaggaccacttccatctgagcaaatgaagctcttctacagt
aaccctcgtttccatgggctccggttcccagctgttaaccatcctcagtcattagagaga
agataccttggaattttaaatagtgttttacttgacctaatgaagaatttactgaagttg
gacccagctgacagatacttgacagagcagtgtttaaatcatcctacatttcagactcag
agacttttggaccggtctccttcaagatcaacaaaaaggaaaccttatcatgtggaaagc
agcaccctgtctaatagaaaccaatccaccaagggtgctgccttacagactcaccacaga
tccaacagcaaggacattcagaacttaagtgtgggtctgcccagggctgaggaaggcctg
cctgcaaacgaaagcttcctcaatggaaaccttgctggagcaactctcagcccaatgcac
accaaaacctaccaagcaagcacccagcctggctcttccagcaaagatctcacaaacaac
aacataccacaccttctcagtccaaaagaagccaagtccaaaacagagtttgacttcaat
attgacacaaagccttcagaaggtccaggcacaaagtacctcaagtccagcaccagatct
cagcagaacaggcactcattcatggaaagctcccagagcaaagctgggaccctgcagccc
agtgagaagcagagtcggcacagctatattgacaccattccccagtcctcccggagtcca
tcctacaggacaaaggccaaaagccatggggcgttgagtgactccaagtctgtgagcaac
ctttccgaagccagagcccaaatcacagagactaataccagtagatacttcccatccagt
tgtttggacttgaactctcccaccagcccaacccccaccaggcacactgatacgagaact
ttgctcagcccttccggtcgaaataatagaaatgaaggcactctggactcacggcgaacc
accactagacactcaaaaaccatggaggagttgaagctgcctgaacacatggacagcagc
cattcgcattcactgtctgcacctcatgaatcattttcttatgggctaggctacaccagc
cccttctcctctcagcagcgtcctcacaggcattccatgtacgtgacccgggacaaagtg
agagcgaaaggccttgatggaagcttgagcataggacaagggatggcagccagagccaac
agtttgcagctcttatcaccccagcctggagaacagctccctccagagatgactgtggca
agaccttctgttaaagagtcctcccgagaaggcgcctcttcattccacacccgtcagaag
tctgagggtggagtataccatgacccacactctgacgacggcacagctcccaaagaaaat
cggcatctgtacaatgaccctgtcccaaggagagttggtagcttttatagagtgccatct
ccacgaccagacaattctttccatgaaaataatgtgtccactcgagtttcttctctgcca
tctgatagcagttctggtacaaatcattcaaaaagacaaccaggatttgatccatggaaa
agtcctgaaaacattagtcatgccgatcaactcaaagaaaaggagaagcaaggttttttc
aggtcaatgaaaaagaaaaagaagaaaactcaaacagtgcccaacactgacggtcctgat
ctattgaccttacagaaagccattcattcttctagcactgcaagcagcagaccaaaggag
tggcgacctgagaagctctcagatctacagacccagagccaaccactaaaatctcttcga
aagctgttgcatctgtcttcatcaaccaatcatccagcttcttcagatcctcggttccag
cccttaacagctcaacaagccaaaaattccttctcagaaattcggattcaccctctgagt
caggccactggtgggagcagcaacatccggcaggagcctacaccaaaaggcagaccagcc
cttcagttgccaggatcttccctcttaaggtacaacggatggaaacactcaagatcaaga
tccagccagccagacgaagtgatcttcttggcatcccatgagaaatggaaacagtga

DBGET integrated database retrieval system