KEGG   Mus musculus (mouse): 382406
Entry
382406            CDS       T01002                                 

Gene name
Poc1b, 4933430F16Rik, Wdr51, Wdr51b
Definition
(RefSeq) POC1 centriolar protein B
  KO
K16482  centriolar protein POC1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    382406 (Poc1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    382406 (Poc1b)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 eIF2A Nup160 IKI3
Other DBs
NCBI-GeneID: 382406
NCBI-ProteinID: NP_082016
MGI: 1918511
Ensembl: ENSMUSG00000019952
Vega: OTTMUSG00000032479
UniProt: Q8BHD1
Position
10; 10 C3- D1
AA seq 476 aa
MASGLEDPILERSFKGHKAAITSADFSPNCKQIATASWDTFLMLWSLKPHARAYRYVGHK
DVVTSLQFSPQGNLLASASRDRTVRLWVLDRKGKSSEFKAHTAPVRSVDFSADGQLLVTA
SEDKSIKVWSMFRQRFLYSLYRHTHWVRCAKFSPDGRLIVSCSEDKTIKIWDTTNKQCVN
NFSDSVGFANFVDFNPNGTCIASAGSDHAVKIWDIRMNKLLQHYQVHSCGVNCLSFHPLG
NSLVTASSDGTVKMLDLIEGRLIYTLQGHTGPVFTVSFSKDGELLTSGGADAQVLIWRTN
FIHLHCKDPKRNLKRLHFEASPHLLDIYPRSPHSHEDRKETIEINPKREVMDLQSSSPPV
VDVLSFDSTTMTDSTYRAVPGKGEDICRYFLNPLLMPECSSTTVKKRPEDVSDVPSESLR
SVPLAVADALEHIMEQLNILTQTVSILEQRLSLTEDKLRDCLENQQKLFSAVQQKS
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggcctccggcctggaggatccgattctggaacgttcttttaaaggtcacaaagctgcc
atcacctccgctgacttcagccccaactgcaaacaaattgctactgcttcgtgggacacc
tttctcatgctatggagtttgaagccacacgctagagcttacagatacgtgggccacaag
gatgttgtaaccagcctgcagttctcgccacaaggaaacctattagcctctgcctcgagg
gacagaactgttagactgtgggttcttgataggaaagggaagtcttcagaatttaaagca
cacacagccccagttcggagtgtggacttttccgctgatggccagcttttggttacagca
tctgaagataaatccattaaagtgtggagtatgttccgtcagcgcttcctctactccctg
tatcgacacacacactgggtacgctgcgccaaattttcacctgacggaaggttgatcgtg
tcatgtagtgaggataaaactattaaaatttgggacactaccaataagcagtgcgttaat
aacttctcagactctgtaggatttgcaaattttgtggattttaaccccaacggcacatgc
atcgcttcagcaggttctgaccatgctgtgaaaatctgggatataagaatgaacaaatta
ctccagcactaccaagttcacagctgcggtgtgaactgtctgtccttccatcctttgggt
aacagccttgtcaccgcctcttctgatggaacagttaagatgctggatctcatagaggga
agactcatatacacacttcaaggacatacggggcccgtctttaccgtttcattttcgaag
gacggagagctgcttacatcaggcggggcagatgcgcaggtcttgatttggaggaccaac
ttcattcacctgcactgtaaagatcctaaaagaaacctcaaaagactgcactttgaggcc
tccccacaccttcttgacatctacccacggtcaccgcattcccatgaagacagaaaggag
actattgaaattaatcccaagcgtgaggtgatggatttgcagagctcgtctccccccgtg
gtggatgtcctttctttcgattcaaccacaatgacggattccacctatcgagctgtgcca
ggcaagggtgaagacatctgtaggtatttcttgaaccctttgttaatgccagaatgttca
tccacaactgtgaaaaagagaccagaagatgtaagtgatgtgccctccgaaagcctgagg
agcgtcccgctggcggtggctgacgcactggagcacattatggaacaactcaacatccta
acccagactgtttcaattctggagcagcgactgtctttgacagaagataagctgagagac
tgccttgagaatcagcaaaagcttttcagcgctgtccaacagaagagctga

DBGET integrated database retrieval system