KEGG   Mus musculus (mouse): 382427
Entry
382427            CDS       T01002                                 

Gene name
Best3, Vmd2, Vmd2l3, mBest, mBest4
Definition
(RefSeq) bestrophin 3
  KO
K13880  bestrophin-3
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    382427 (Best3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   382427 (Best3)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 382427
NCBI-ProteinID: NP_001007584
MGI: 3580298
Ensembl: ENSMUSG00000020169
UniProt: Q6H1V1
Position
10; 10 D2
AA seq 669 aa
MTVTYSSKVANATFFGFHRLLLKWRGSIYKLLYREFIVFAVLYTAISLVYRLLLTGAQKR
YFEKLSIYCDRYAEQIPVTFVLGFYVTLVVNRWWNQFVNLPWPDRLMLLISSSVHGSDQH
GRLLRRTLMRYVNLTSLLIFRSVSTAVYKRFPTMDHVVEAGFMTADERKLFDHLKSPHLK
YWVPFIWFGNLATKARNEGRIRDSVDLQSLMTEMNRYRSWCSLLFGYDWVGIPLVYTQVV
TLAVYTFFFACLIGRQFLDPTKGYVGHDLDLYVPIFTLLQFFFYAGWLKVAEQLINPFGE
DDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMKKDIYWDDSAARPPYTLAAADYCIPSFL
GSTIQMGLSGSNFPAEDWLWNYEKHGNRHSVMRRVKRFLSTHEHPGSPRRRRSFGRQASD
SSMFLPPSPARDLLDVPSRNPHRGSPTRKQSRSQEGSPKLHSSMGELSTIRETSRTSTLQ
SLSPQSSVRSSPTKMPQVPEVLITAAEAPAFSADSHQHDSTTSILSLEFTGVQPSGTEQQ
VEPSGTPPGDPNPQTTSASTERDLFKFEEDLEDDRFPKRWSLPEFLESRHTSLGNLGPDP
VSPRDALLLPDTETPSETNGIHPGAGSALAPDILYLMESLDKETDILEFNNEHTGESPKG
TPQRPRTWF
NT seq 2010 nt   +upstreamnt  +downstreamnt
atgactgtcacttactccagtaaagtagcaaatgcaacattttttggatttcataggttg
cttctcaagtggagaggtagtatctacaagctgctgtacagggaatttattgtttttgct
gttctttacacagcaatcagtctggtgtacagattgttacttacaggagcccaaaaacgt
tactttgaaaaattatcaatttactgtgacagatatgctgaacaaattccagtaaccttt
gtgcttgggttttacgtcactctggtagtgaaccgatggtggaaccagtttgtgaatctg
ccttggccagacaggctgatgctcctcatttccagcagtgtccacgggagcgaccagcat
gggcgcctgctcagaaggacgctgatgcgctacgtcaacctgacgtccctgctcatcttc
cgctcggtgagcaccgcggtgtacaagaggtttcccaccatggaccacgtggtcgaagca
ggttttatgacggcagatgagaggaaattattcgaccacctcaaatcgcctcatctgaag
tactgggttcccttcatttggtttggaaatcttgcaaccaaagcccggaatgaaggcaga
atcagagacagcgttgatctacaatcactgatgactgaaatgaatcggtaccgctcttgg
tgcagcctcttatttggttacgactgggttggcattccgctggtttacacacaggtcgtc
accctcgccgtctacacgttcttctttgcgtgcctgatcggaaggcagttcctggatccc
accaaaggctacgtaggacatgacttggatctgtacgttcccatcttcactctcctccag
ttcttcttctacgcaggatggctcaaggttgcagagcagctgatcaaccctttcggggaa
gatgacgatgactttgaaacaaactggtgcattgacagaaacctgcaggtctctctcttg
gctgtggatgaaatgcatatgagtttgcccaagatgaagaaggacatttactgggacgat
tctgctgcccggccaccgtacacactggcggctgccgactactgcataccgtcctttctg
ggctcaacgatccaaatggggctgtccgggtccaacttccccgcagaggactggctgtgg
aactacgagaaacacggaaaccggcactcagtgatgaggagggtcaagcgcttcctgagt
acccacgagcatcctggcagccccaggaggaggaggagcttcggcaggcaggccagcgac
agctccatgttcttacccccaagcccagctcgggatctgctggatgtgccgtccaggaac
ccccaccgaggctcgcccacacggaagcaatcccgctcccaagagggcagccccaagctg
cactccagcatgggagaactgtccaccatcagggagaccagccgtaccagcacgctgcag
agcctgagcccgcagtccagcgtgaggtcctcccctaccaaaatgccccaggtccctgag
gtcctaatcaccgccgctgaagcaccagcgttctcagcagacagccatcagcatgactcc
actacctccatcttgagcctcgagttcaccggggtgcagccgagcgggactgagcagcag
gtagagccttcagggaccccacctggagaccccaatccccagactacttcagccagtact
gaaagagacttgttcaagttcgaggaagatctagaggatgacagatttcccaaaaggtgg
agcctgccagagtttctggagtccaggcacacctcgctgggaaacttaggtccagatcct
gtgagtccccgggatgctcttcttttacctgacacagaaacaccctcagagaccaacgga
atccatcctggggctggctctgccctcgcccccgacatcctgtacttaatggaaagtttg
gataaggaaacagacatcttggagtttaacaacgagcacactggagaatccccgaaggga
acaccacagcgccccaggacctggttctaa

DBGET integrated database retrieval system