KEGG   Mus musculus (house mouse): 382543
Entry
382543            CDS       T01002                                 
Symbol
Ankfn1, 4932411E22Rik, Gm1175, mWAKE, nmf9
Name
(RefSeq) ankyrin-repeat and fibronectin type III domain containing 1
  KO
K24478  ankyrin repeat and fibronectin type-III domain-containing protein 1
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    382543 (Ankfn1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type III domain-containing proteins
   382543 (Ankfn1)
SSDB
Motif
Pfam: fn3 Ank_2 Ank_4 Pur_ac_phosph_N Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 382543
NCBI-ProteinID: NP_001314739
MGI: 2686021
Ensembl: ENSMUSG00000047773
Position
11:complement(89280918..89668727)
AA seq 1152 aa
MCPVMETSPNRRLPFKDRHFTCSKIIGRRFACFAQRLSYRRKQSQCDLLNESTGHLPATC
SSAASKSLSWNYCSKMTQQMQNLHLSQSKKHSAPSSPNAAKRLYRNLSEKLKGSHSSFDE
AYFRTRTDRLSLRKTSVNFQGNEAMFEAVEQQDLDAVQLLLYQYTPEELDLNTPNSEGLT
PLDIAIMTNNVPIARILLRTGARESPHFVSLESRAMHLNTLVQEAQDRVSELSAQVENEG
FTLDNTEKEKQLKAWEWRYRLYRRMKTGFEHARAPEVPANACLMVSSSTSLTVSFQEPLS
VNAAVVTRYKVEWSMSKDFSPLAGEIIMDNLQTLRCTITGLTTGQQYFVQVSAYNMKGWG
PAQTTTPVCASPSNWKDYDDREPRHKGQSEVLESLLQQVRALHQHYSCRESSKLQTTGRK
QSVSRSLKHLFHSSNKFVKTLKRGLYIATIFYYKDNMLVTNEDQIPIVEIDDSHTSSITQ
DFLWFMKLSCMWEDIRWLRQSVPISMSSSTVLQTRQKMLAATAQLQNLLGTHNLGRLYYE
PIKDRHGNILIVTIREVEMLYSFFNGKWMQISKLQSQRKSLSTPEEPTALDILLITIQDI
LSYHKRSHQRLSPGLYLGYLKLCSSVDQIKVLVTQKLPNILCHVKIRENHNISKEEWEWI
QKLSGSESMESVDHNADCPMQLFFYELQMAVAALLKQINIPRHQARNFRLYTQEVLEIGH
NVSFLLLLPASDDVCTAPGQNNPYTPHSGFLNLPLQMFELVHFCSYREKFISLYCRLSAV
VELDSLNTQQSLREAISDSEVAAAKQRHQQVLDFIQQIDEVWREMRWIMDALQYARYKQP
VSGLPITKLIDSSSEQNLKKISSTSSHIDCLPSTSPSPEMHRRKAVSESQPCSDEEGCSE
VFLPTDSDYDSSDALSPRDLDLVYLSSHDIAQQALSGLSGSAPDVLQVHDMKASMGPGQD
PQGPGQGPDTDHSCVEFLHSLTLTGLAPKNHAKMVAGTRPPLGFLGKRKPGKHQHYGGFS
RHHRWLRMHSETQSLSLSEGVYTQHLSQACGLAEDPGEAEGPGPVVDGPRGLPLAHAASL
PEERRSCLQDPRRPLQRVYVEPYSDTLAGQDPKLWTSLSPTPAGRSSLPSSTSSEMSPDP
TSPVSEILSSML
NT seq 3459 nt   +upstreamnt  +downstreamnt
atgtgtcctgtcatggagacatcaccaaacaggaggctgcccttcaaagacagacatttt
acttgcagcaaaataataggaaggaggttcgcttgctttgcgcagaggctgagctacagg
agaaagcagagccaatgtgatttattgaatgaaagcactggacacttaccagcaacttgt
tcctctgctgcctcgaagagcttaagctggaactactgctcgaaaatgacccagcaaatg
cagaacttacatctttcccagtcaaaaaaacacagtgctccatcgtctcccaatgctgcc
aagcgactgtacaggaacctctcggagaagctgaagggcagtcactcgtcctttgatgag
gcctattttagaacaagaacggatcggctgagtctcagaaagacttctgtgaacttccag
ggcaacgaagccatgtttgaggcagttgagcaacaggacctagatgctgtgcaactcctc
ctctaccaatatacaccggaagaactagatctgaacacaccgaacagcgaagggctgaca
cccctggacatcgccatcatgaccaacaacgtgcccattgcgaggattcttctgcggaca
ggagccagagaaagtccgcactttgtcagcctggagagccgagcaatgcatctcaacact
ctagttcaggaggcccaggacagggtgagtgagctgtctgcacaggtggagaatgaaggc
ttcaccctggacaacacagagaaagagaagcagctgaaggcctgggagtggaggtaccgg
ctctaccggcgcatgaaaactggcttcgaacatgcccgagccccagaggtgccagccaat
gcctgtctcatggtaagcagcagcacgtccctaacggtcagctttcaagagcccctcagt
gtcaacgcagccgtagtgaccaggtacaaagtggaatggagcatgtctaaagacttttcc
ccgttggctggggagatcatcatggataacctgcagaccctgaggtgtacaatcacagga
ctcaccacgggccaacagtattttgttcaagtctcagcttacaacatgaaaggatgggga
ccagctcagaccacaacgccagtgtgtgcctccccctccaactggaaagactatgacgac
agagagcccagacacaagggacagagtgaggttctggagagcctactgcagcaagtccga
gcccttcatcagcattacagctgccgggaaagctcaaaactgcaaaccacaggccgcaag
cagtcggtgtccaggagcctgaagcacctatttcattcctcaaacaagttcgtgaagacc
ttgaaacgaggactttacatagccactatattttattataaagacaatatgttagtcacc
aatgaagaccaaataccaattgttgaaatagatgactctcacaccagttctattacacaa
gactttctgtggttcatgaagctgtcttgtatgtgggaagacatcaggtggctgaggcaa
agcgtgcccatatccatgtcctcgtccactgtgctgcaaactcggcaaaagatgcttgct
gccacagctcagctacagaatttacttggaacacacaacttgggaagactttactatgag
cccattaaagatcgccatggcaacattctcatagttaccatcagagaagtggagatgctt
tattccttttttaatggcaaatggatgcaaatctcaaaactgcaaagccagaggaagtct
ctgtcaacacccgaagagccaacagccttagatattttactaataaccatccaggatatt
ctgtcctaccacaagaggagccatcagcggctctcacctggactgtatctaggttaccta
aagctgtgtagctctgtggatcagatcaaagtgctcgtaacccaaaagctacccaacatt
ctctgccacgtgaagatccgtgaaaaccacaacatttccaaagaggagtgggagtggatc
caaaagctttctggctctgagtctatggaaagtgtggatcataatgctgactgccccatg
caattgttcttctacgagctccagatggcagtggcggctctcctgaagcagatcaatata
cctcgacaccaggcaaggaacttccgcctctacacacaggaggtgttggaaattggtcac
aatgtgtcctttcttctcttgctccctgcctcagacgacgtctgtacagccccaggacag
aataatccttacaccccgcactcagggtttcttaacctccctcttcagatgtttgaactc
gttcatttttgcagctacagagagaaatttattagtctgtattgccgcctttctgctgtt
gtggagctggactctctgaatacccaacagtccctgagggaggcaatctcagacagcgag
gtcgcagctgccaaacaacggcaccagcaagtgctggactttattcagcaaattgatgaa
gtctggcgtgagatgagatggatcatggatgctctacagtatgcccggtacaagcaacca
gtctctggcttgcccatcactaagctgatagactcctccagtgagcagaatctaaagaag
atcagttctacgtcatcacacatagactgtcttccgtcaacatccccatcgccagagatg
cacagaagaaaggcagtgagtgagtcacagccctgctcggatgaagaaggctgctcggaa
gtcttcctccccacagacagtgactatgactccagcgatgccctgagcccacgagacctg
gacctggtttacctgtcatcacatgacatagcccagcaggccctcagcggcctcagtggc
agcgccccagatgtcctacaggtgcatgacatgaaggcctccatgggacctggccaggac
cctcagggcccagggcagggtcctgacaccgaccactcatgtgtcgagtttctccacagc
ctgaccctcacgggcttggcacccaagaaccatgccaagatggtggcaggcacacggccg
ccactgggcttcttgggaaagcggaagccaggcaagcaccagcactatggtggcttcagc
cgccaccaccgctggctgcgcatgcacagcgagacgcagtccctgtcactctccgaaggt
gtttacacccagcacctgtctcaggcctgcggcctggctgaagatcctggggaggcagag
gggcctggacctgtggtggatgggccccgaggcctgcctctggcccatgcagccagcctc
ccagaggagaggaggagctgcctccaagacccaaggcggcccctgcagagagtctatgtg
gaaccctattccgacacactcgcaggccaggatccaaagctgtggaccagtttgagccct
acccctgcaggccgcagcagcctcccaagctccactagttcagagatgagtccagacccc
acatctccagtttcagaaatattaagtagtatgctttag

DBGET integrated database retrieval system