KEGG   Mus musculus (mouse): 382639
Entry
382639            CDS       T01002                                 

Gene name
Zbtb42, EG382639, Gm5188, simiRP58
Definition
(RefSeq) zinc finger and BTB domain containing 42
  KO
K23196  zinc finger and BTB domain-containing protein 18/42
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    382639 (Zbtb42)
   03036 Chromosome and associated proteins [BR:mmu03036]
    382639 (Zbtb42)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    382639 (Zbtb42)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    382639 (Zbtb42)
SSDB
Motif
Pfam: BTB zf-C2H2_4 zf-H2C2_2 zf-C2H2 zf-C2H2_jaz zf-LYAR
Other DBs
NCBI-GeneID: 382639
NCBI-ProteinID: NP_001093930
MGI: 3644133
Ensembl: ENSMUSG00000037638
Vega: OTTMUSG00000037611
UniProt: Q811H0
Position
12; 12 F1
AA seq 420 aa
MEFPEHGVRLLGRLRQQRELGFLCDCTVLVGDARFPAHRAVLAACSVYFHLFYRDQPASS
RDTVRLNGDIVTVPAFSRLLDFMYEGRLDLHNLPVEDVLAAASYLHMYDIVKVCKGRLRK
KDPDLETRTLGTELPGQPPHPLPSWSPAFCQAAPKAKHPSLGVKATHPLPTFGPPSWQVA
EQSSGALDLSLKPSPRPEQVHPPCRLQTSLCSSVQQVAQPLVKAEQDSFSEQDSSSPQSA
DRSPPPVCASAAQGLAVDLEPLHIEGTGSQQLGLPAEPVLDSEELGPSRHLCICPLCCKL
FPSTHALQLHLSAHFRERDSVRARLSPEGSVPTCPLCSKTFSCTYTLKRHERTHSGEKPY
TCVQCGKSFQYSHNLSRHAVVHTREKPHACRWCERRFTQSGDLYRHVRKFHYGLVKPLLV
NT seq 1263 nt   +upstreamnt  +downstreamnt
atggagttcccggagcacggcgtacggctgctgggccgcctgaggcagcagcgcgagctg
gggttcctgtgcgactgcactgttctggtgggcgacgcgcgcttccctgcgcaccgcgct
gtactggccgcgtgcagtgtctacttccatctcttctacagggatcagcccgcgagcagc
cgcgacacggtgcggctcaacggcgacatcgtcacggtacccgccttcagccgcctgctg
gacttcatgtacgagggccgcttggacctgcacaacctacctgtcgaggacgtcctggct
gccgccagttacctgcacatgtatgacatcgtcaaggtctgcaagggcagactcagaaag
aaggacccagatctggagacccgtacgctggggacagagcttcctgggcagccaccacac
cccctgccttcctggtcccctgccttctgccaagccgcaccaaaggccaaacacccatct
ctaggggtcaaggctacccatcccctgccaacatttggacctccgtcttggcaggttgca
gagcagtcaagtggggccctggacctgtcactgaagcctagcccaagaccggagcaggta
cacccaccctgtcgcctccagacatccctctgcagctccgtacagcaagtggcgcagcct
ctggtgaaggctgagcaagattcgttctcagaacaagatagcagcagcccgcagagcgcg
gaccgatccccaccaccagtctgtgcttctgcagcccagggcctggcagtggacttggag
ccactgcacatcgaagggacgggcagccagcagcttgggctgcctgcagagccagtgctc
gacagtgaagagctgggtcccagcaggcacctttgcatttgcccgctatgctgcaagctg
ttccctagcacccacgcactgcagctgcatctcagcgcccacttccgggagcgggacagt
gtccgtgccaggctctcccccgaggggtccgtgcccacgtgcccactctgcagcaagacc
ttctcctgcacatacaccctgaagaggcatgaacggacacactctggggagaagccctat
acctgcgtgcagtgtggcaagagcttccagtactcacacaacttaagccggcatgctgtg
gtccacacgcgggagaagccccatgcctgccgctggtgtgagcgcagattcacacagtcc
ggtgacctgtaccgccatgtccgcaagttccactatggcctagtcaagcccttgcttgtg
tga

DBGET integrated database retrieval system