KEGG   Mus musculus (mouse): 382864Help
Entry
382864            CDS       T01002                                 

Gene name
Colq, A130034K24Rik
Definition
(RefSeq) collagen-like tail subunit (single strand of homotrimer) of asymmetric acetylcholinesterase
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen DUF4215 SGL
Motif
Other DBs
NCBI-GeneID: 382864
NCBI-ProteinID: NP_034067
MGI: 1338761
Ensembl: ENSMUSG00000057606
Vega: OTTMUSG00000033849
UniProt: O35348
Position
14; 14 B
AA seq 457 aa AA seqDB search
MVVLNPMTLGIYLQLFFCSIVSQPTFINSVVPISAALPGLDQKKRGSHKACCLLMPPPPP
LFPPPFFRGSRSPLLSPDMKNLLELEASPSPCIQGSLGSPGPPGPQGPPGLPGKTGPKGE
KGDLGRPGRKGRPGPPGVPGMPGPVGWPGPEGPRGEKGDLGMMGLPGSRGPMGSKGFPGS
RGEKGSRGERGDLGPKGEKGFPGFPGMLGQKGEMGPKGESGLAGHRGPTGRPGKRGKQGQ
KGDSGIMGPPGKPGPSGQPGRQGPPGPPGPPSAGQLVMGLKGERGFPGPPGRCLCGPPVN
VNNPSYGDSMYGRGSPRVPAIFVVNNQEELERLNTQNAIAFRRDQRSLYFKDSLGWLPIQ
LTPFYPVGYTVKQPGTCGDGVLQPGEECDDGNPDVSDGCIDCHRAYCGDGYRHQGVEDCD
GSDFGYLTCETYLPGSYGDLRCTQYCSIDSTPCRYFT
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcctgaatccaatgactttgggaatttatctccaactcttcttctgctccatc
gtgtctcagccaactttcatcaacagtgtggtcccaatctcagcagcccttcctggcctg
gatcagaagaagcggggcagccacaaagcatgctgcctactcatgcccccaccgccccca
ctcttcccaccgccgttcttcagaggcagccggagcccgcttctctccccagacatgaag
aaccttctggaacttgaggcgtcaccatcaccctgcattcaaggctcgctcggctctcct
gggccccctgggccccagggtccacctgggcttcctggcaagacaggaccaaagggagaa
aagggggaccttggccgcccaggaaggaagggtagacctggacccccaggtgttcctggc
atgcctgggcccgttggctggccaggccctgaaggacccaggggtgaaaaaggtgacctg
ggtatgatgggcctgccggggtcaagaggaccgatgggctctaagggtttccctggatcc
agaggggaaaagggatccagaggtgaaaggggtgacttgggtcccaaaggagaaaagggt
ttccctgggtttcctggaatgctggggcagaaaggtgaaatgggtccaaagggagagtct
gggctggcaggacaccgaggccccacaggaagaccaggaaaacgaggcaagcagggtcag
aagggagacagtggaattatgggcccaccaggcaagcctgggccttctggtcaacctggc
cgtcaaggtcctccagggcccccaggcccaccatctgcaggacaacttgtaatgggactc
aaaggggaaagaggatttccagggcctccaggaagatgcctttgcggaccccctgtgaat
gtgaataacccctcctacggggactccatgtatgggcgtggctcccctcgagttcctgcg
atttttgtggtcaacaaccaggaagagcttgagaggctgaacactcagaatgccattgcc
tttcgaagagaccagcgatctttgtacttcaaagatagccttggctggctccccatccag
ctcacccctttctaccctgtgggttacaccgtgaagcagcctggcacctgcggggatgga
gtcctgcagcctggggaagagtgtgatgatggtaatcccgatgtgagtgatggctgcatc
gactgtcatcgggcctactgtggagacggttaccggcaccagggcgtggaggactgtgac
ggctctgactttggctacctgacatgcgagacctatctccctggatcatacggagacctt
cggtgcacccagtactgctccatcgactccacaccctgccgctacttcacgtga

DBGET integrated database retrieval system