KEGG   Mus musculus (mouse): 383348
Entry
383348            CDS       T01002                                 

Gene name
Kctd16, 2900055J20Rik, 4930434H12Rik, Gm1267
Definition
(RefSeq) potassium channel tetramerisation domain containing 16
  KO
K21918  BTB/POZ domain-containing protein KCTD8/12/16
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    383348 (Kctd16)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     383348 (Kctd16)
SSDB
Motif
Pfam: BTB_2 BTB_3 GLYCAM-1 Dynein_C
Other DBs
NCBI-GeneID: 383348
NCBI-ProteinID: NP_080411
MGI: 1914659
Ensembl: ENSMUSG00000051401
UniProt: Q5DTY9
Position
18; 18 B3
AA seq 427 aa
MALSGNCSRYYPRDQGAAVPNSFPEVIELNVGGQVYFTRHSTLISIPHSLLWKMFSPKRD
TANDLAKDSKGRFFIDRDGFLFRYILDYLRDRQVVLPDHFPERGRLKREAEYFQLPDLVK
LLAPEDVKQSPDEFCHSDFEDASQGSDTRICPPSSLLPHDRKWGFITVGYRGSCTLGREG
QADAKFRRVPRILVCGRISLAKEVFGETLNESRDPDRAPERYTSRFYLKFKHLERAFDML
SECGFHMVACNSSVTASFVNQYTEDKIWSSYTEYVFYREPSRWSSSHCDCCCKNGKGDKG
ESGTSCNDLSTSSCDSQSEASSPQETVICGPVTRQSNIQTLDRPIKKGPVQLIQQSEMRR
KSDLLRTLTSGSRESNISSKKKAAKEKLSIEEELEKCIQDFLKIKIPDRFPERKHPWQSE
LLRKYHL
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctctaagtgggaactgtagccgttattatcctcgggaccagggggctgctgttccc
aactccttccctgaagtcatagagctgaatgttggcggccaggtttacttcactcgccat
tccacattaataagcatcccccattctctcctgtggaaaatgttctccccaaagagagac
actgctaacgatctagccaaggactccaagggaaggtttttcattgacagagatggcttt
ctgttccgttatattctggactatctcagggacaggcaggtggtcctgcctgatcacttt
ccagaaagaggaaggctgaaaagagaagctgagtacttccagctccctgacctcgtcaaa
ctcctggcccccgaggatgtcaagcaaagcccggatgagttctgccacagtgacttcgaa
gatgcctcccaaggaagcgacacgagaatctgccccccctcttcgctgcttcctcacgac
cgcaagtggggttttattactgtgggttacaggggatcctgtaccttgggcagagagggg
caagcagatgccaagttccggagagtcccccggattttggtttgcggaagaatttccttg
gcaaaagaagtctttggagaaactttgaatgaaagtagagaccccgaccgagctccagaa
agatacacctccagattttatctcaagtttaaacatctggaaagagcttttgatatgttg
tcagagtgtggattccacatggtggcctgtaactcctcggttacagcatcttttgtcaac
cagtatacagaagataagatctggtcgagctatactgagtacgtcttctatcgtgagcct
tcccggtggtcctcctctcattgtgactgctgctgcaagaatggcaagggagacaaagga
gagagcggcacctcctgcaatgacctgtccacttccagctgtgacagccagtcagaggcc
agctctccgcaggagacggtgatctgtgggcctgtaacgcgccagagcaacatccagact
ctggatcggcccatcaagaaaggtccggtgcagctgatccaacagtcagagatgaggcgg
aaaagtgacctgctccggactctgacgtcaggctccagggagtcgaacataagcagcaaa
aagaaagctgcgaaggaaaagctctccatcgaggaagagctggagaaatgtatccaggat
ttcttgaagataaaaattccagatcgcttccctgagcgaaaacatccttggcagtctgaa
cttttacggaagtatcatctatag

DBGET integrated database retrieval system