KEGG   Mus musculus (house mouse): 383491
Entry
383491            CDS       T01002                                 
Symbol
Prdm14
Name
(RefSeq) PR domain containing 14
  KO
K24646  PR domain zinc finger protein 14 [EC:2.1.1.-]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    383491 (Prdm14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-
     383491 (Prdm14)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 PRDM
    383491 (Prdm14)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz SET zf-C2H2_6 zf-Di19 zf_UBZ zf-C2HC_2 zf-C2H2_11 zinc_ribbon_15 Zn-ribbon_8
Other DBs
NCBI-GeneID: 383491
NCBI-ProteinID: NP_001074678
MGI: 3588194
Ensembl: ENSMUSG00000042414
UniProt: E9Q3T6
Structure
Position
1:complement(13183652..13197387)
AA seq 561 aa
MALPPSGETQSQDKANYLPQSNPHHLTTYYAHAPGYSHFRNLATTEEEFQPWKLAAAVLE
SQAMAPLDAFRMTAPLLNPGLAVQSEPLYNLPWYKLSPWNRIPQFTPEVPRFLDSTEHRS
SGSSNQNLVLGGGGGQISGQRWEAENLLLPSPVIASLLPDGIKSSQSISVPQTLNQEGKL
PFCGFNFTEEELSFVLYGAIASPEHPTDLQHAISGILVPTESSGSNHLHKTLDKDSLQLP
EGLCLMQTSFGDVPHFGVFCSDFIAKGVRFGPFRGRVVNASEVKAHRDNSRMWEIFEDGH
LSHFIDGKGSGNWMSYVNCARFPKEQNLLAVQHQGQIFYESCRDIQRNQELLVWYGNGYE
KFLGVPMNLRVTEQGGQQLSESSEESAEGYRCERCGKVFTYKYYRDKHLKYTPCVDKGDR
KFPCSLCQRSFEKRDRLRIHILHVHERHRPYLCSTCGKSFSQSSSLNKHMRVHSGDRPYQ
CVYCTKKFTASSILRTHIRQHSGEKPFKCKHCGKAFASHAAHDSHVRRSHKDNGRSSCDI
CGKGFLDQEAFYAHMRLHKTC
NT seq 1686 nt   +upstreamnt  +downstreamnt
atggccttaccgccctctggtgagacccagtcccaggacaaggcgaactacctgccccag
agcaaccctcaccacctgactacctactacgcgcatgccccaggctacagtcactttagg
aacctcgccaccaccgaggaggagtttcaaccttggaaactggcagctgcagtgcttgag
tcccaggcgatggcccctcttgatgcttttcggatgactgctcccttgttgaacccgggt
ctggctgttcagagcgagccgctctacaatctgccctggtacaaattgtcaccatggaac
cgaattcctcaattcactcccgaagtaccacgatttctagacagcactgagcataggagc
agcggttccagcaaccaaaatttggtcctcggcggcggcggtggccaaatcagtggtcag
aggtgggaagctgaaaatttacttctgccatccccggtaattgcttccctactacctgat
ggaattaagtcgtcccagtcaatatctgtcccccaaaccttgaatcaagaggggaagctg
ccgttttgcggcttcaacttcacagaggaggaactgagcttcgttctgtatggagccatc
gctagtccggagcacccaaccgacttacagcatgcaatttcaggcatcctggttcccaca
gagagttctgggtctaatcatcttcataaaaccctggacaaagactccctccagcttccg
gaaggtctctgcctcatgcagacctcatttggtgatgtgccacactttggcgtgttctgc
agcgacttcattgccaaaggagtgagatttggaccctttcgaggtagagtggtcaatgcc
agcgaagtgaaggcacacagggacaactctcggatgtgggaaatttttgaagatggtcac
ctgagccattttatcgacggcaaaggttctgggaactggatgtcctatgtcaactgtgct
cggttccccaaggagcagaacctgctggccgtgcagcaccaagggcagatattttatgag
agttgtagagacatccagcggaaccaggaactgcttgtgtggtacggaaatggctatgag
aagttcctgggcgttcccatgaacctccgtgtcactgagcaaggaggccagcagctgtct
gagtcctctgaagagtctgcagaaggttacagatgtgaacgctgtggaaaggtgtttacc
tacaaatactacagagataagcacctgaagtacacgccctgtgtggacaagggggacagg
aagtttccgtgttctctctgccaaagatcctttgaaaagcgcgaccgcctccggatccat
attcttcacgtccatgagaggcaccggccctacctgtgttcaacctgtgggaaaagtttt
tctcagtcttccagcctgaacaagcacatgagagtccactctggagacaggccataccag
tgcgtgtactgtacaaagaagttcactgcctccagcatactccgaacacacatcagacag
cactcaggagagaagcccttcaagtgcaagcattgtggtaaagcctttgcatctcatgct
gcccacgacagccacgtccggcgctcacacaaggacaatggccgtagctcctgcgatatt
tgtgggaaaggcttcctggatcaagaggctttctatgcccacatgaggcttcataaaacc
tgctag

DBGET integrated database retrieval system