KEGG   Mus musculus (mouse): 384059
Entry
384059            CDS       T01002                                 

Symbol
Tlr12, Gm1365, Tlr11
Name
(RefSeq) toll-like receptor 12
  KO
K18807  toll-like receptor 12
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    384059 (Tlr12)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   384059 (Tlr12)
SSDB
Motif
Pfam: LRR_8 LRR_4 TIR_2 TIR LRR_9
Other DBs
NCBI-GeneID: 384059
NCBI-ProteinID: NP_991392
MGI: 3045221
Ensembl: ENSMUSG00000062545
Vega: OTTMUSG00000009457
UniProt: Q6QNU9 A2RRZ9
Position
4; 4 D2.2
AA seq 906 aa
MGRYWLLPGLLLSLPLVTGWSTSNCLVTEGSRLPLVSRYFTFCRHSKLSFLAACLSVSNL
TQTLEVVPRTVEGLCLGGTVSTLLPDAFSAFPGLKVLALSLHLTQLLPGALRGLGQLQSL
SFFDSPLRRSLFLPPDAFSDLISLQRLHISGPCLDKKAGIRLPPGLQWLGVTLSCIQDVG
ELAGMFPDLVQGSSSRVSWTLQKLDLSSNWKLKMASPGSLQGLQVEILDLTRTPLDAVWL
KGLGLQKLDVLYAQTATAELAAEAVAHFELQGLIVKESKIGSISQEALASCHSLKTLGLS
STGLTKLPPGFLTAMPRLQRLELSGNQLQSAVLCMNETGDVSGLTTLDLSGNRLRILPPA
AFSCLPHLRELLLRYNQLLSLEGYLFQELQQLETLKLDGNPLLHLGKNWLAALPALTTLS
LLDTQIRMSPEPGFWGAKNLHTLSLKLPALPAPAVLFLPMYLTSLELHIASGTTEHWTLS
PAIFPSLETLTISGGGLKLKLGSQNASGVFPALQKLSLLKNSLDAFCSQGTSNLFLWQLP
KLQSLRVWGAGNSSRPCLITGLPSLRELKLASLQSITQPRSVQLEELVGDLPQLQALVLS
STGLKSLSAAAFQRLHSLQVLVLEYEKDLMLQDSLREYSPQMPHYIYILESNLACHCANA
WMEPWVKRSTKTYIYIRDNRLCPGQDRLSARGSLPSFLWDHCPQTLELKLFLASSALVFM
LIALPLLQEARNSWIPYLQALFRVWLQGLRGKGDKGKRFLFDVFVSHCRQDQGWVIEELL
PALEGFLPAGLGLRLCLPERDFEPGKDVVDNVVDSMLSSRTTLCVLSGQALCNPRCRLEL
RLATSLLLAAPSPPVLLLVFLEPISRHQLPGYHRLARLLRRGDYCLWPEEEERKSGFWTW
LRSRLG
NT seq 2721 nt   +upstreamnt  +downstreamnt
atgggcaggtactggctgctgccaggtctcctcctttccctgcctctggtaactgggtgg
agcacttccaactgcctggtgaccgaaggctcccgactgcccctggtctcccgctatttc
acattctgccgccattccaagctatcctttcttgctgcatgcctctccgtgagcaacctg
acacagaccttggaagttgtacctcggactgtggaggggctctgcctcggtggtactgtg
tctactctgcttccagatgctttctctgcttttcctggtctcaaggtcctggcactgagt
ctgcaccttacccaacttctgccaggagctctccggggtctgggacagttgcagagcctc
tctttttttgactctcctcttaggagatctctctttctacctcctgatgccttcagtgac
ctgatttccctccagagactccatatctctggcccttgcctggataagaaggcaggcatc
cgcctgcctcccggtctgcaatggctgggtgtcacgctcagttgcattcaggacgtggga
gagctggctggtatgttcccagatctggtgcaaggttcctcctccagggtttcgtggacc
ctgcagaagttggatctgtcatccaactggaagctgaagatggctagtcctgggtccctc
cagggtctccaggtggagattctggacctgacaagaacaccactggatgccgtgtggctg
aagggcctgggacttcagaaactcgatgtcttgtatgcacagactgccacggccgagctg
gctgctgaggctgttgcccactttgagctgcagggcttgattgtgaaagaaagcaagata
ggatctatatctcaggaggctctggcttcctgccacagcctgaagaccttgggtctttca
agcactggcctaaccaagcttccaccaggcttcctgactgccatgcctaggcttcagcga
ctggagctgtccggaaaccaactgcagagcgccgtgctgtgcatgaatgagacgggagat
gtgtcaggactcacgactctggatctgtcaggcaacaggttgcgcatcctgcctccagcc
gccttctcctgcttaccccacttgcgagagctgctgcttcggtacaaccagctgctttcc
ctggagggatacctattccaggagctccagcaactagagaccttgaagctggatggaaac
cccctgcttcacctgggtaagaactggttggcggctctgcctgcattgaccacccttagc
ttgctagatacccaaatacggatgagcccagagcctggcttctggggagcaaagaatctg
cataccttgagcctgaagcttcccgctctccctgctccggcagtattgttcctgcccatg
tatctgaccagcttagagcttcatatagcctcaggcacgacggagcactggacgctgtcc
ccagcgatctttccttccttggagaccttgactataagcggcgggggactgaagctgaag
ctggggtcccagaatgcttctggggtcttccctgctctccagaagctctccctgcttaag
aacagcttggatgccttctgctcccagggtacctccaaccttttcctctggcagctcccc
aaacttcagtccttgagggtatggggtgctggaaacagctccagaccctgccttatcact
gggctgcccagcctacgggagctgaagctggcgtcgcttcagtccataacccagccccgt
tcggtgcagctggaggagctggtgggtgaccttccacagctccaggccttagtgctatcc
agcacaggcctcaagtcactgtcggctgctgctttccagcgcctgcacagtctccaggtc
ttagtgctagaatacgagaaggacttgatgctgcaggacagtctgagggagtacagccct
cagatgccccactatatatacattctggagtcaaacctggcctgccactgtgccaatgcg
tggatggagccatgggttaagcggtccactaaaacgtacatatacataagagacaatcgc
ttatgtccaggacaagacaggctctctgctaggggttcccttccctcctttctctgggac
cactgcccccagacgttggagctgaaactctttttggctagttctgccttggtgttcatg
ctaattgccttgcctctcctccaagaagccaggaactcttggatcccctacctgcaggcc
ttgttcagggtttggctccagggtctgaggggtaagggagacaaggggaagaggttcctt
tttgatgtattcgtgtcccactgcaggcaagaccagggctgggtgatagaggaacttctg
cctgctctggagggcttccttccagctggcctgggcctgcgcctctgtctccccgagcgt
gactttgagcctggtaaggatgtagttgataatgtggtagatagcatgttgagcagccgt
accacactctgcgtgttgagtgggcaggccctgtgtaacccccgatgccgcctggagctc
cgcttggccacctctctcctcctggctgccccgtcccctccagtgttgctgctagtcttc
ttggaacccatttctcggcaccagcttccgggttaccacagactggctcggctgcttcga
agaggagactactgtctgtggcccgaggaagaggagagaaagagtgggttctggacttgg
ctgaggagcaggctagggtag

DBGET integrated database retrieval system