KEGG   Mus musculus (house mouse): 384619
Entry
384619            CDS       T01002                                 
Symbol
Kash5, Ccdc155, Gm1434
Name
(RefSeq) KASH domain containing 5
  KO
K22595  protein KASH5
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    384619 (Kash5)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   LINC complex
    384619 (Kash5)
SSDB
Motif
Pfam: KASH_CCD EF-hand_9 CCDC22 Leu_zip CC149 Fez1 FlxA IMD EF-hand_7 GldM_N
Other DBs
NCBI-GeneID: 384619
NCBI-ProteinID: NP_958762
MGI: 2687329
Ensembl: ENSMUSG00000038292
UniProt: Q80VJ8
Position
7:complement(44833043..44854344)
AA seq 648 aa
MHSILRSSLSSREALRMRQLKGLRKERPGRHPLGVRLRAIWTSFLFPNPPHSGGKLRAST
AAVEEHQEWSMDLPEGQAGGPTAQMYLWEQPEEASSRPLLSLEEQILNSTFEACDPHKTG
TVTVAHLLAYLEAVTGQGPQDVRLQTLARSLDPYGEGAGATVELDTFLVVMRDWIAACQL
QGGLERAEETAYEGALASPHLPSVCPEAEESANLESFGGEDPRPEGPATAELLSNLEDLE
LSNRRLAGENAKLQRSVETAEEGSARLGEEITALRKQLRSTQQALQVAKALDEELEDLKT
LAKSLEEQNRSLMAQARHTEKEQQHLAAEVETLQEENEKLLAERDGVKRRSEELATEKDA
LKRQLCECERLICQREAVLSERTRHAESLARTLEEYRTTTQELRQEISNLEEQLSQSQEG
PEELLEGAEAGRVGWIMALPPSLDLEIQAIRQEQDVASAGLSSPLYGVWQWEEVEPEPEP
EPEPEPEPEPQEVEFPSEDPARQQTDLQREPVRALEGSRAPCLRLSRSQEEEEEEEESWV
LADPSSPLGTYHHKLAPGSSRESCHIVPEMHQALMPVVRDLVPVERSRTQHCLHPQHSPG
IRISQHPLVPTPVLGLLLLLLLSILLFSQSPPPTWPHLQLYYLQPPPV
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgcactcgatcctcaggtccagcctatcctcccgagaagctctacgcatgcgccagctc
aagggtcttcgtaaggagagacccgggcgccatccactcggagtgcgcttgcgagctatc
tggacatcctttcttttccccaaccctcctcacagtggagggaagctgagagcttcgaca
gcagctgtagaggagcatcaggagtggtccatggacctgccggagggccaggctggtggt
ccaactgcacagatgtacctctgggaacagcccgaggaagcgagttcaaggccactgctc
agcctagaggaacagatccttaactccacatttgaagcctgtgaccctcacaagacaggc
actgtgactgtggcccacctcctggcctacctggaggctgtgacaggacagggacctcag
gatgtgcgcctccaaacactggcccggagcttggacccttatggagagggtgctggagcc
actgtggaactggacacctttctggtggtcatgcgggactggattgctgcctgtcagctg
caggggggattagagcgggcagaggagaccgcctacgagggagccctggcttctccacac
ctgccatctgtgtgcccagaagctgaggagtcagccaacttagagagctttggaggagaa
gaccccaggcccgaggggcctgccacagctgagctgctgagcaacctggaggacctagag
ctaagcaaccggcgtcttgctggtgagaatgccaagctacaacgcagtgtggagactgcg
gaggagggctctgcacgcctaggggaggagatcacagccctgcgcaagcagctgcgaagt
acccagcaggccctgcaggtggccaaggctttggatgaggagctagaggacctgaagact
ctggccaagagcctagaggagcagaatcgcagtctgatggcccaggcccggcacacagag
aaggagcagcagcacctggcggctgaggtagagacgctacaggaggagaatgagaagctg
ctagctgagagagatggagtgaaaaggcggagtgaggagttggccacagagaaggacgct
ttgaagcggcagctctgtgagtgcgaacgactcatttgccagcgtgaagcagtcctctca
gagcgtacccgccatgcagagagtctggcccggaccttggaggagtacagaactaccacc
caggaactaaggcaagagatctcaaacctggaggagcagctgagtcagagccaggaaggc
ccagaggagctgctggaaggggctgaggcaggaagagtaggctggatcatggccctgccc
ccatcactagacttggagatccaagctatccgacaggagcaggatgtagccagtgctggc
ctctctagtcctctgtatggagtgtggcagtgggaagaggtggagcctgagcctgagcct
gagcctgagcctgagcctgagcctgagccgcaggaggttgagtttccctctgaggaccct
gctaggcaacagacagacttgcagagagagccagtgcgtgctctagaaggaagcagagct
ccatgcttgcggttgtccagaagccaggaagaggaggaagaagaagaggagagctgggtc
ctggctgacccttccagccctctgggaacctatcaccataaacttgccccaggaagctct
cgtgagagttgccacattgtaccagagatgcaccaagccctcatgcctgtggtgagagac
ctggtgccagttgagaggtcacggacccagcactgtctgcatccccagcactccccaggg
atcagaatcagccagcacccactggtccccacacccgtcttgggcctgctgctgctgctg
ctgctctccatcctgctgttcagccagtccccgccacccacctggcctcacctgcagctc
tactacctacagccgccaccagtgtga

DBGET integrated database retrieval system