KEGG   Mus musculus (house mouse): 387349
Entry
387349            CDS       T01002                                 
Symbol
Tas2r121, T2R21, Tas2r13, Tas2r21, mGR21, mT2r48
Name
(RefSeq) taste receptor, type 2, member 121
  KO
K08474  taste receptor type 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    387349 (Tas2r121)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    387349 (Tas2r121)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    387349 (Tas2r121)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 387349
NCBI-ProteinID: NP_996907
MGI: 2681259
Ensembl: ENSMUSG00000071150
UniProt: Q7M720
Position
6:complement(132677053..132677970)
AA seq 305 aa
MGSNVYGILTMVMIAEFVFGNMSNGFIVLINCIDWVRKGTLSSIGWILLFLAISRMVLIW
EMLITWIKYMKYSFSFVTGTELRGIMFTWVISNHFSLWLATILSIFYLLKIASFSKPVFL
YLKWREKKVLLIVLLGNLIFLMLNILQINKHIEHWMYQYERNITWSSRVSDFAGFSNLVL
LEMIVFSVTPFTVALVSFILLIFSLWKHLQKMHLNSRGERDPSTKAHVNALRIMVSFLLL
YATYFISFFLSLIPMAHKTRLGLMFSITVGLFYPSSHSFILILGHSNLRQASLWVMTYLK
CGQKH
NT seq 918 nt   +upstreamnt  +downstreamnt
atgggaagcaatgtgtatggtatcttaactatggttatgattgcagagtttgtatttgga
aatatgagcaatggattcatagtgctgataaactgcattgattgggtcaggaaaggaact
ctttcttccattggttggatcctgcttttcttggccatttcaagaatggtgttgatatgg
gaaatgttaataacatggataaaatatatgaagtattcattttcatttgtgactggaaca
gaattacggggtatcatgtttacctgggtaatttccaatcacttcagtctctggcttgcc
actattctcagcatcttttatttgctcaaaatagccagtttctccaaaccggtttttctc
tatttgaagtggagagagaagaaagtgcttctgattgtccttctgggaaatttgatcttc
ttgatgctcaacatattacaaataaacaaacatatagaacactggatgtatcaatatgag
agaaatataacttggagttctagagtgagtgactttgcagggttttcaaatctggtctta
ttggagatgattgtgttctctgtaacaccattcacagtggccctggtctccttcatcctg
ttaatcttctccttgtggaaacatctacagaaaatgcatctcaattctagaggggaacga
gaccccagcactaaagcccatgtgaatgccttgagaattatggtctccttcctcttactc
tatgccacttacttcatatctttttttctatcattgattcccatggcacataaaacacga
ctgggtcttatgtttagcataactgttgggcttttctacccttcaagccactcatttatc
ttaattttgggacattctaatttaaggcaagccagtctttgggtgatgacatatcttaaa
tgtgggcaaaagcattag

DBGET integrated database retrieval system