KEGG   Mus musculus (mouse): 387351
Entry
387351            CDS       T01002                                 

Gene name
Tas2r124, T2R24, Tas2r24, mGR24, mt2r50
Definition
(RefSeq) taste receptor, type 2, member 124
  KO
K08474  taste receptor type 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    387351 (Tas2r124)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    387351 (Tas2r124)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    387351 (Tas2r124)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 387351
NCBI-ProteinID: NP_996909
MGI: 2681267
Ensembl: ENSMUSG00000060412
Vega: OTTMUSG00000056955
UniProt: Q7M718
Position
6 G1; 6 64.03 cM
AA seq 309 aa
MVPVLHSLSTIILIAEFVWGNLSNGLIVLKNCIDWINKKELSTVDQILIVLAISRISLIW
ETLIIWVKDQLISSITIEELKIIVFSFILSSHFSLWLATALSIFYLFRIPNCYWQIFLYL
KWRIKQLIVHMLLGSLVFLVANMIQITITLEERFYQYGGNTSVNSMETEFSILIELMLFN
MTMFSIIPFSLALISFLLLIFSLWKHLQKMPLNSRGDRDPSATAHRNALRILVSFLLLYT
IYFLSLLISWVAQKNQSELVHIICMITSLVYPSFHSYILILGNYKLKQTSLWVMRQLGCR
MKRQNTPTT
NT seq 930 nt   +upstreamnt  +downstreamnt
atggtacctgttctgcacagtctctccaccatcatactaattgcagagtttgtttgggga
aatttgagcaatggtttgatagtgttgaagaactgcattgactggatcaataaaaaagag
ctctccacagttgatcaaatactcattgtcttggcaatttcaagaattagtctcatctgg
gaaacactaattatatgggttaaagatcaactaatttcatctattactattgaagaatta
aaaataattgtgttcagctttatactatctagccacttcagtctctggcttgctacagct
ctcagcatcttctatttattcagaatacctaattgctactggcagatctttctctacttg
aaatggagaataaagcaactgattgtccacatgcttctgggaagcttggtgttcttggtt
gcaaatatgatacagataaccatcactcttgaagagaggttctatcaatatggaggaaat
acaagtgtaaattccatggagactgagttctcaattttgatagagctgatgttatttaac
atgactatgttctccattataccattttcattggccttaatttcttttcttctgctaatc
ttctctttatggaaacatctccagaagatgccactcaattctagaggagatagagaccct
agtgctacggcccacagaaatgccttgagaattttggtctccttcctcttgctctatact
atatatttcctgtctcttcttatatcatgggttgctcagaagaatcaaagtgaactggtt
cacattatttgtatgataacttcacttgtgtatccttcattccactcatatatcctgatt
ctgggaaattataaattaaagcagacctctctttgggtaatgaggcagctgggatgtagg
atgaaaagacagaatacaccaactacataa

DBGET integrated database retrieval system