KEGG   Mus musculus (house mouse): 387352
Entry
387352            CDS       T01002                                 
Symbol
Tas2r125, T2R26, Tas2r25, mGR25, mt2r59
Name
(RefSeq) taste receptor, type 2, member 125
  KO
K08474  taste receptor type 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    387352 (Tas2r125)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    387352 (Tas2r125)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    387352 (Tas2r125)
SSDB
Motif
Pfam: TAS2R 7tm_1 DUF6755
Other DBs
NCBI-GeneID: 387352
NCBI-ProteinID: NP_996910
MGI: 2681269
Ensembl: ENSMUSG00000059410
UniProt: Q7M710
Position
6:132886614..132887549
AA seq 311 aa
MMGIAIDILWAAIIIVQFIIGNIANGFIALVNIIDWVKRRKISLMDKIITALAISRIYLL
WSTFLITLTSSLDPDIKMAVKIIRISNNTWIIANHFSIWFATCLSIFYFLKIANFSNYIF
LYLRWRFKKVVSVTLLISLIFLLLNILLMNMHIDIWSDKSKRNLSFSVRSNNCTQFPRLV
LLINTMFTSIPFTVSLLAFLLLIFSLWRHLKTMQYYAKGSEDTTTAAHIKALHMVVAFLL
FYTVFFLSLAIQYWTSGSQENNNLFYATIVITFPSVHSCILILRNSQLRQASLLVLWWLL
CKSKDVRMLVP
NT seq 936 nt   +upstreamnt  +downstreamnt
atgatgggtattgccatagatatcttatgggcagctattatcattgtgcaattcataatt
gggaatattgcaaatggattcatagcattggtgaacatcatagactgggtgaagagaaga
aaaatctctttaatggataagatcattactgctttggcaatctctaggatttatctgctg
tggtctacattcttaattacactaacatcttcactggatccagatattaaaatggctgtg
aaaatcattagaataagcaataacacctggattattgcaaatcatttcagcatttggttt
gctacatgtctcagcatcttttattttctcaagatagccaatttttctaactatattttt
ctctacttaaggtggagatttaagaaggtggtttcagtgacattgctaatctctcttatc
ttcctgcttttaaatattttactgatgaacatgcatattgatatctggagtgataagtcc
aaaagaaacctttcttttagtgtcagatcaaataattgcactcagtttcccagacttgtc
cttttaatcaacacaatgttcacatcaatccccttcactgtgtccctgttggcttttctg
cttctcatcttctccctgtggagacacctgaaaaccatgcaatactatgctaaaggctcc
gaagacaccaccacagctgcacatataaaggccttgcacatggtagtggcctttctcctg
ttctacacagttttctttttgtctcttgccatacaatattggacctctgggtctcaagag
aataacaacctgttttatgccacaattgtaattactttcccttcagtccattcatgtatc
ctgattctgagaaacagccagctgaggcaggcatctctgttggtgctgtggtggctgctg
tgcaagtccaaagatgtacggatgttggttccctga

DBGET integrated database retrieval system