KEGG   Mus musculus (house mouse): 387353
Entry
387353            CDS       T01002                                 
Symbol
Tas2r126, T2R12, T2R26, Tas2r26, Tas2r41, mGR26, mt2r35
Name
(RefSeq) taste receptor, type 2, member 126
  KO
K08474  taste receptor type 2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    387353 (Tas2r126)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    387353 (Tas2r126)
G protein-coupled receptors [BR:mmu04030]
 Others
  Chemoreception
   Taste
    387353 (Tas2r126)
SSDB
Motif
Pfam: TAS2R
Other DBs
NCBI-GeneID: 387353
NCBI-ProteinID: NP_996911
MGI: 2681273
Ensembl: ENSMUSG00000048284
UniProt: P59532
Position
6:42411469..42412395
AA seq 308 aa
MLPTLSVFFMLTFVLLCFLGILANGFIVLMLSREWLLRGRLLPSDMILFSLGTSRFFQQC
VGLVNSFYYFLHLVEYSGSLARQLISLHWDFLNSATFWFCTWLSVLFCIKIANFSHPAFL
WLKWRFPALVPWFLLGSILVSVIVTLLFFWGNHTIYQAFLRRKFTGNTTFKEWNRRLEID
YFMPLKVVTMSIPCSLFLVSILLLISSLRRHSLRMQHNTHSLQDPNVQAHSRALKSLISF
LVLYAVSFVSMIIDATVFISSDNVWYWPWQIILYFCMSVHPFILITNNLRFRGTFRQLLL
LARGFWVA
NT seq 927 nt   +upstreamnt  +downstreamnt
atgctaccaacattatcagttttcttcatgttgacctttgttctgctctgtttcctgggg
atcctggccaacggcttcattgtgctgatgctgagcagggaatggctactgcgtggtagg
ctgctcccctcggacatgatcctcttcagtttgggcacctcccgattcttccagcagtgt
gtgggattggtcaacagtttctattacttcctccatctggttgagtactccgggagcctt
gcccggcagctcattagtcttcactgggacttcttgaactcagccactttctggttttgt
acctggctcagcgtcctgttctgtatcaagattgctaacttctcccatcctgccttcctg
tggttgaagtggagattcccagcgttggtgccctggttcttgttgggctctatcttggtg
tccgtcattgtaactctgctgttcttttggggaaaccacactatatatcaggcattctta
aggagaaagtttactgggaacacaacctttaaggagtggaacagaaggctggaaatagac
tatttcatgcctctgaaagttgtcaccatgtcaattccttgttctctttttctggtctca
attttgctgttgatcagttctctcagaaggcattcgctaagaatgcagcacaatacccac
agcttgcaagaccccaacgtccaggctcacagcagagccctgaagtcactcatctcattc
ctggttctttatgcggtgtcctttgtgtccatgatcattgatgctacagtcttcatctcc
tcagataatgtgtggtattggccctggcaaattatactttacttttgcatgtctgtacat
ccatttatcctcatcaccaataatctcaggttccgcggcaccttcaggcagctactcctg
ttggccaggggattctgggtggcctag

DBGET integrated database retrieval system