KEGG   Mus musculus (mouse): 394436Help
Entry
394436            CDS       T01002                                 

Gene name
Ugt1a1, Gnt1, UDPGT_1-1, UGT1A01, Udpgt-1a, UgtBr1
Definition
(RefSeq) UDP glucuronosyltransferase 1 family, polypeptide A1
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00040  Pentose and glucuronate interconversions
mmu00053  Ascorbate and aldarate metabolism
mmu00140  Steroid hormone biosynthesis
mmu00830  Retinol metabolism
mmu00860  Porphyrin and chlorophyll metabolism
mmu00980  Metabolism of xenobiotics by cytochrome P450
mmu00982  Drug metabolism - cytochrome P450
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
mmu05204  Chemical carcinogenesis
Module
mmu_M00014  Glucuronate pathway (uronate pathway)
mmu_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    394436 (Ugt1a1)
   00053 Ascorbate and aldarate metabolism
    394436 (Ugt1a1)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    394436 (Ugt1a1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    394436 (Ugt1a1)
   00860 Porphyrin and chlorophyll metabolism
    394436 (Ugt1a1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    394436 (Ugt1a1)
   00982 Drug metabolism - cytochrome P450
    394436 (Ugt1a1)
   00983 Drug metabolism - other enzymes
    394436 (Ugt1a1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    394436 (Ugt1a1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:mmu01003]
    394436 (Ugt1a1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     394436 (Ugt1a1)
Glycosyltransferases [BR:mmu01003]
 Others
  Hydrophobic molecule
   394436 (Ugt1a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_2 Pox_A14
Motif
Other DBs
NCBI-GeneID: 394436
NCBI-ProteinID: NP_964007
MGI: 98898
Ensembl: ENSMUSG00000089960
Vega: OTTMUSG00000020815
UniProt: Q63886
Position
1 D; 1 44.55 cM
AA seq 535 aa AA seqDB search
MTVVCWSSRLLLLLPYLLLCVFGPSASHAGRLLVFPMDGSHWLSMLGVIQQLQQKGHEVV
VIAPEASIHIKEGSFYTLRKFPVPFQKENVTATLVELGRTAFNQDSFLLRVVKIYMKVKR
DSSMLLAGCSHLLHNAEFMASLEESHFDALLTDPFLPCGSIVAQYLTVPTVYFLNKLPCS
LDSEATQCPVPLSYVPKSLSFNSDRMNFLQRVKNVLLAVSENFMCRVVYSPYGSLATEIL
QKEVTVQDLLSPASIWLMRSDFVKDYPRPIMPNMVFIGGINCLQKKPLSQEFEAYVNASG
EHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQN
DLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEM
TADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAA
HDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggtgtgctggagctcgcgtttgcttctgcttcttccgtaccttctgttgtgt
gtgttcggtccctctgcatcccacgctgggaggctgttagtgttccctatggatggaagc
cactggctgagtatgcttggagttattcagcagctccagcagaaggggcacgaagttgtg
gtcatagcacctgaagcctcaatacacataaaagaaggatcattttacactctgaggaag
ttccctgtgccattccagaaggaaaatgtgacagctactttggtggaacttggacggact
gcctttaatcaagattcttttctgctgcgcgtggtcaaaatatatatgaaagtcaaaagg
gattccagtatgctcctagctggctgctcccacctgctgcacaatgccgagtttatggcc
tctctggaagaaagtcactttgatgctctgctgacagaccctttccttccctgtggctcc
attgtggcccagtacctgactgtgcccactgtgtacttcttgaataaattgccatgcagc
ctggattcagaagctacccaatgccccgtcccattgtcctacgtgcccaagagtttgtct
ttcaactcagaccgcatgaacttcctacagcgagtgaagaacgtgctcctggccgtgtca
gagaactttatgtgcagagtggtttattccccctatgggtcacttgccactgaaatctta
cagaaagaagtgactgtccaggatcttctgagccctgcatctatctggctgatgagaagt
gactttgtgaaagattaccccaggcccatcatgcccaacatggtttttattggtggtata
aattgccttcagaaaaagcccctatcccaggaatttgaagcctatgtcaacgcctctggg
gagcatggcatcgttgttttctctttgggatccatggtctcagagattccggagaagaaa
gccatggaaattgctgaggctttgggcagaattcctcagacggtcctgtggcgctacacc
ggaactagaccatcgaatcttgcaaagaacacaattcttgtcaaatggctaccccaaaat
gatctgcttggtcatccaaagactcgggcattcatcacacactctggctcccatggtatt
tatgaaggaatatgcaatggagttccgatggtgatgatgcccctatttggcgatcagatg
gacaatgccaagcgcatggaaactcggggagctggggtgaccctgaatgtccttgaaatg
actgctgatgatttggaaaatgcccttaaaactgtcatcaacaacaagagctacaaggag
aacatcatgcgcctctccagccttcacaaggaccgtcctatagagcctctggacctggct
gtgttctgggtggaatacgtgatgaggcacaagggggcaccacacctgcgcccggccgcc
catgacctcacctggtatcagtaccactccttggatgtgattggcttcctcctggccatt
gtgttgacagtggtcttcattgtctttaaatgttgtgcctatggctgccggaaatgcttt
gggggaaaggggcgagtgaagaaatcacacaaatccaagacccattga

DBGET integrated database retrieval system