KEGG   Mus musculus (house mouse): 399566
Entry
399566            CDS       T01002                                 
Symbol
Btbd6
Name
(RefSeq) BTB (POZ) domain containing 6
  KO
K10478  BTB/POZ domain-containing protein 3/6
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    399566 (Btbd6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     399566 (Btbd6)
SSDB
Motif
Pfam: PHR BTB BACK
Other DBs
NCBI-GeneID: 399566
NCBI-ProteinID: NP_964008
MGI: 3026623
Ensembl: ENSMUSG00000002803
UniProt: Q8K2J9 G5E817
Position
12:112937880..112943113
AA seq 539 aa
MLLPLACLHGRVAQCLTSLLVLAEPFPRPRRGAKARGAAPTSAEPAPAVAKMAAELYPPA
SPSAATATDIANSNAAGAAESTKVGLCCPPCLAPAPLPPLPAPPLPDNNNPESPNWQSFH
PTLRERNALMFNNELMADVHFIVGALGAARRVPAHKYVLAVGSSVFYAMFYGDLAEVKSE
IHIPDVEPAAFLVLLKYMYSDEIDLEADTVLATLYAAKKYIVPALAKACVNFLETSLEAK
NACVLLSQSRLFEEPELTQRCWEVIDAQAEMALRSEGFCEIDRQTLEIIVTREALNTKEA
VVFEAVLNWAEAECKRQGLPVTPHNKRHVLGRALYLVRIPTMTLEEFANGAAQSDILTLE
ETHNIFLWYTAAKKPLLDFPLTKRKGLAPQRCHRFQSSAYRSNQWRYRGRCDSIQFAVDR
RVFIAGLGLYGSSSGKAEYSVKIELKRLGMVLAQNLTKFVSDGSSNTFPVWFEHPVQVEQ
DTFYTASAVLDGSELSYFGQEGMTEVQCGKVAFQFQCSSDSTNGTGVQGGQIPELIFYA
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgctgctgccgctcgcctgcctgcatgggcgggtggcgcagtgcctaacctccctgctg
gtgctcgcagagccgtttcccaggccccgtcgcggcgcgaaggcgcgcggcgcagcaccg
accagtgcggagcccgccccggcagtagcgaagatggccgcggaactgtacccgcccgcc
agtccctctgcagctactgccaccgacatcgccaacagcaacgcggcaggcgcagccgag
agcacgaaggtcgggctttgctgcccgccctgcctggcacccgccccgctgccgcccttg
cccgcgccgcccttgccagacaacaacaatcccgagagccccaactggcagtccttccat
cctacgctgcgcgagaggaatgcgctcatgttcaacaacgagctgatggctgacgtccac
ttcatcgtgggggctctgggggctgccaggcgtgtgcccgcccacaagtatgtcttggct
gtcggcagctccgtcttctatgccatgttctacggggatcttgcggaagtgaagtcagaa
atccacattcccgatgtggagcctgctgccttcttggtcttgctaaagtacatgtacagc
gatgagatcgacctggaggcggacacagtgcttgccactctgtatgctgctaagaagtac
atcgtgcctgccctggccaaggcctgcgtcaactttctggaaacaagtctggaagccaaa
aatgcttgtgtcctgctgtcccagagccgactgtttgaggagcctgaactgacccagaga
tgctgggaagtcattgatgcacaagctgaaatggccctgaggtctgaaggcttctgtgaa
attgaccggcagacactggagatcattgtgaccagggaggccctcaataccaaggaggct
gtggtcttcgaggccgtcctgaactgggctgaggcagaatgtaagagacagggcctccca
gtcactcctcacaacaagaggcatgttttgggaagagccctctacctggtccgaattcca
actatgaccttagaggagtttgccaatggtgccgcccagtcagacatcctgaccttagaa
gagacccacaacatcttcctttggtacactgctgccaaaaagcccctccttgacttcccc
ctgaccaagaggaagggccttgctccacaaaggtgccaccgcttccagtcttctgcctac
cgaagtaaccagtggaggtaccgtggacgctgtgacagcatccagtttgcagtggacaga
agggtgttcattgctgggctgggcttgtatgggtccagctctgggaaggctgagtacagc
gtcaagattgaactcaagcggctagggatggtcctggctcagaacctcaccaagtttgtt
tcagacggatccagcaacactttcccagtctggtttgagcacccggtccaggtggagcag
gacaccttctacactgccagtgctgtcctggacggcagtgagctcagctactttgggcaa
gaaggaatgacagaggtgcagtgtgggaaggtagccttccagttccagtgctcctcagac
agtaccaatgggactggagttcagggtggacagattccagagctcatcttctatgcctga

DBGET integrated database retrieval system